ESTScan Details for Unigene SGN-U286923

Score 
435
Direction 
Forward
Predicted Peptide Sequence 
GNENHLMSLIITKFRANNSYQDKTVPQISENXNDKPTKTRIINYLGSSYFFYTIALAADAILGHRSAHSLPIGPVMAALMESDDGSDNSS
QPLAVHVWKNAFWGVDHQWDGDLFATAGAQVDIWNHNRSQPVNSFEWGKDTVTSVRFNPGEPNLLATSASDRSISIYDLRLSTPARKVIM
ATKTNSIAWNPMEPMNFTAANDDGRCYSYDVRKLNEAKCVHIDHTSSVMDIDYSPTG
Predicted Coding Sequence 
XTTGGAAATGAGAACCATTTGATGTCATTGATCATCACAAAATTTCGAGCAAATAATTCTTATCAAGACAAAACTGTTCCTCAGATATCC
GAAAACTTXAATGACAAACCAACAAAAACAAGAATCATAAACTACTTGGGGAGCTCCTACTTCTTCTACACAATAGCATTGGCAGCAGAT
GCAATCCTAGGCCATAGATCAGCACATTCTTTACCAATTGGACCAGTGATGGCAGCTCTAATGGAGTCTGATGATGGATCTGATAACTCA
TCCCAGCCATTGGCTGTTCATGTTTGGAAGAATGCATTCTGGGGTGTTGACCACCAATGGGATGGTGATCTTTTTGCCACAGCTGGTGCT
CAAGTTGACATTTGGAACCATAACAGGTCTCAGCCGGTTAATAGTTTTGAATGGGGGAAAGACACAGTTACATCTGTTCGGTTTAATCCA
GGGGAACCTAATCTTTTGGCTACATCAGCAAGTGATCGAAGCATAAGCATCTATGATTTACGGCTTTCTACACCAGCTAGAAAGGTTATT
ATGGCGACAAAAACTAATTCTATAGCATGGAATCCGATGGAGCCAATGAATTTTACTGCCGCTAATGATGATGGAAGATGCTACAGTTAT
GATGTTAGAAAGTTAAATGAAGCCAAATGTGTGCATATAGATCATACCTCTTCAGTGATGGATATAGATTATTCACCAACCGGT\
Edits in Original Sequence 
(5')XTTGGAAATGAGAACCATTTGATGTCATTGATCATCACAAAATTTCGAGCAAATAATTCTTATCAAGACAAAACTGTTCCTCAGAT
ATCCGAAAACTTXAATGACAAACCAACAAAAACAAGAATCATAAACTACTTaGGGGAGCTCCTACTTCTTCTACACAATAGCATTGGCAG
CAGATGCAATCCTAGGCCATAGATCAGCACATTCTTTACCAATTGGACCAGTGATGGCAGCTCTAATGGAGTCTGATGATGGATCTGATA
ACTCATCCCAGCCATTGGCTGTTCATGTTTGGAAGAATGCATTCTGGGGTGTTGACCACCAATGGGATGGTGATCTTTTTGCCACAGCTG
GTGCTCAAGTTGACATTTGGAACCATAACAGGTCTCAGCCGGTTAATAGTTTTGAATGGGGGAAAGACACAGTTACATCTGTTCGGTTTA
ATCCAGGGGAACCTAATCTTTTGGCTACATCAGCAAGTGATCGAAGCATAAGCATCTATGATTTACGGCTTTCTACACCAGCTAGAAAGG
TTATTATGGCGACAAAAACTAATTCTATAGCATGGAATCCGATGGAGCCAATGAATTTTACTGCCGCTAATGATGATGGAAGATGCTACA
GTTATGATGTTAGAAAGTTAAATGAAGCCAAATGTGTGCATATAGATCATACCTCTTCAGTGATGGATATAGATTATTCACCAACCGGT\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan