ESTScan Details for Unigene SGN-U286986

Score 
462
Direction 
Forward
Predicted Peptide Sequence 
MGSSGGINYGSYTYENLGEXGTLTGAXXEKLPXYXXXLLGAGGFIASHIARRLKSEGHYIIASDWKKNEHMTEDMFCHEFHLADLRVMDN
CLKVTKGVDHVFNLAADMGGMGFIQSNHSVIFYNNTMISFNMMEAARINSVKRFFYASSACIYPEFKQLETNVSLKEADAWPAEPQDAYG
LEKL
Predicted Coding Sequence 
ATGGGAAGCTCTGGTGGTATTAACTATGGTTCTTACACTTATGAGAATCTTGGAGAGNGGGGAACXCTTACTGGGGCCATNNCTGAGAAA
CTTCCGCNNTATTNTNNCCANTTACTGGGGGCTGGAGGATTTATCGCTTCTCACATTGCTCGTCGTTTGAAGAGCGAGGGCCACTACATA
ATTGCCTCCGATTGGAAGAAGAATGAGCACATGACAGAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAAT
TGCTTGAAGGTAACAAAAGGTGTTGACCATGTCTTCAATCTCGCTGCTGATATGGGTGGCATGGGTTTCATTCAGTCCAACCACTCGGTT
ATCTTCTATAACAACACTATGATCAGCTTCAATATGATGGAAGCTGCTAGGATTAACAGTGTCAAAAGGTTCTTCTATGCATCTAGTGCT
TGCATATACCCCGAGTTCAAACAACTCGAAACAAATGTCAGCCTGAAAGAAGCTGATGCTTGGCCTGCAGAGCCTCAAGATGCATACGGC
TTGGAAAAGCTT\
Edits in Original Sequence 
CTAATATCTCTCCATTGCCTCAATCTTTTTCTCCTGCATACTTTTAGAGA(5')ATGGGAAGCTCTGGTGGTATTAACTATGGTTCTTAC
ACTTATGAGAATCTTGGAGAGNGGGGAACXCTTACTGGGGCCATNNCTGAGAAACTTCCGCNNTATTNTNNCCANTTACTGGGGGCTGGA
GGATTTATCGCTTCTCACATTGCTCGTCGTTTGAAGAGCGAGGGCCACTACATAATTGCCTCCGATTGGAAGAAGAATGAGCACATGACA
GAGGATATGTTCTGTCATGAGTTTCATCTTGCGGATCTTAGGGTTATGGATAATTGCTTGAAGGTAACAAAAGGTGTTGACCATGTCTTC
AATCTCGCTGCTGATATGGGTGGCATGGGTTTCATTCAGTCCAACCACTCGGTTATCTTCTATAACAACACTATGATCAGCTTCAATATG
ATGGAAGCTGCTAGGATTAACAGTGTCAAAAGGTTCTTCTATGCATCTAGTGCTTGCATATACCCCGAGTTCAAACAACTCGAAACAAAT
GTCAGCCTGAAAGAAGCTGATGCTTGGCCTGCAGAGCCTCAAGATGCATACGGCTTGGAAAAGCTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan