ESTScan Details for Unigene SGN-U287112

Score 
139
Direction 
Forward
Predicted Peptide Sequence 
MDVNLVGRARTLVRVKPLAFVLPFWSPLPNGPTKALRKTGYGKAPSVLVLLPTRELALQVFAAFEXLWPGLLGSLRAXLYGNSPMGAQQA
QLX
Predicted Coding Sequence 
ATGGATGTGAATTTGGTTGGTCGAGCTCGTACCTTGGTCAGGGTAAAACCGTTGGCCTTTGTTTTACCATTTTGGAGTCCCTTACCAAAT
GGTCCTACTAAAGCATTGCGAAAAACAGGATATGGGAAGGCTCCTAGTGTTCTGGTGCTTTTACCTACTAGGGAATTAGCACTTCAGGTG
TTTGCTGCTTTTGAAGXTTTATGGCCGGGGCTGTTGGGCTCACTTCGTGCTGXTCTGTATGGAAATTCTCCNATGGGTGCACAACAGGCT
CAACTAAXX\
Edits in Original Sequence 
TAAGGGAATAGAAGCACTTTTTTCCTTCTTCAAGCCTTATTGACCTTTTGATGATATTCATGA(5')ATGGATGTGAATTTGGTTGGTCG
AGCTCGTACCTTGGTCAGGGTAAAACCGTTGGCCTTTGTTTTACCATTTTGGAGTCCCTTaACCAAATGGTCCTACTAAAGCATTGCGAA
AAACAGGATATGGGAAGGCTCCTAGTGTTCTGGTGCTTTTACCTACTAGGGAATTAGCACTTCAGGTGTTTGCTGCTTTTGAAGXTTTAT
GGCCGGGGCTGTTGGGCTCACTTCGTGCTGXTCTGTATGGAAATTCTCCNATGGGTGCACAACAGGCTCAACTAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan