Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U287122

Score 
125
Direction 
Forward
Predicted Peptide Sequence 
LPYSVSQMTSLRYLNVSHNQIQGQVTVAFDSLSSLDTLQLVESFSGEVYMLKYAGXLQNNQFTGTIDILANLPLXDLNVENNRFTGWVPD
HLKGITKSNGNSWNSGSXPPPPPGTPPASRPDHKSGGNNSPTDGASSGEGGGKWGIGVEPIAGIVISVP
Predicted Coding Sequence 
CTTCCATATTCCGTTTCGCAGATGACTTCCCTCCGATACTTAAATGTCAGTCATAATCAAATTCAAGGACAAGTGACTGTCGCGTTCGAC
TCTCTGTCTTCTCTCGATACATTACAATTGGTTGAGTCCTTCAGTGGTGAAGTTTACATGTTGAAGTATGCAGGTXATTTGCAGAACAAC
CAGTTTACAGGAACTATTGATATCTTAGCCAATCTTCCTCTTGNTGATTTGAATGTTGAGAACAACCGTTTTACTGGCTGGGTTCCTGAT
CACTTGAAAGGGATCACGAAATCAAATGGTAACTCATGGAACTCAGGATCTGAXCCCCCTCCTCCACCTGGCACACCCCCTGCAAGCAGG
CCXGACCACAAATCTGGAGGCAATAATAGCCCTACTGATGGTGCAAGCAGTGGTGAAGGTGGTGGTAAATGGGGGATAGGGGTGGAGCCC
ATTGCAGGCATAGTGATATCTGTTCCX\
Edits in Original Sequence 
(5')CTTCCATATTCCGTTTCGCAGATGACTTCCCTCCGATACTTAAATGTCAGTCATAATCAAATTCAAGGACAAGTGACTGTCGCGTT
CGACTCTCTGTCTTCTCTCGATACATTACAATTGGTTGAGTCCTTCAGTGGTGAAGTTTACATGTTGAAGTATGCAGGTXATTTGCAGAA
CAACCAGTTTACAGGAACTATTGATATCTTAGCCAATCTTCCTCTTGNaTGATTTGAATGTTGAGAACAACCGTTTTACTGGCTGGGTTC
CTGATCACTTGAAAGGGATCACGAAATCAAATGGTAACTCATGGAACTCAGGATCTGAXCCCCCTCCTCCACCTGGCACACCCCCTGCAA
GCAGGCCXGACCACAAATCTGGAGGCAATAATAGCCCTACTGATGGTGCAAGCAGTGGTGAtAGGTGGTGGTAAATcGGGGGATAGGGGT
GGAGCCCATTGCAGGCATAGTGATATCTGTTCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan