Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U287289

Score 
611
Direction 
Forward
Predicted Peptide Sequence 
MKIQCDVCEKAQATVICCADEAALCAKCDIEVHAANKLASKHQRLHLQCLSNKLPPCDICQDKAAFIFCVEDRALFCKDCDEAIHSASSL
AKNHQRFLATGIRVALSSSCNKEAXKKPTGATTTSAEFSTSWLENAYAAIAGITSPSWPVDDLLGFPDYESSDKVKQTYSFYILQVPYVF
DYLRGWGIDVWRTSLDXEAIIFLGKAAYALNLNLKHLNMQNDFLRFLDTX
Predicted Coding Sequence 
ATGAAGATCCAGTGTGATGTGTGTGAGAAAGCTCAAGCTACTGTGATTTGCTGTGCTGATGAGGCTGCTTTGTGTGCAAAATGTGATATT
GAAGTTCATGCTGCTAATAAATTAGCAAGTAAGCATCAGAGGCTTCATCTTCAGTGCCTATCTAACAAGCTTCCTCCTTGTGATATTTGC
CAAGATAAAGCAGCCTTCATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCAAGGACTGTGACGAAGCAATTCATTCAGCCAGCAGCCTC
GCCAAGAACCACCAACGCTTCTTAGCCACTGGAATCCGTGTAGCCTTGAGCTCAAGCTGCAATAAGGAAGCAGXTAAAAAACCAACTGGA
GCCACAACCACCTCAGCAGAATTCTCAACAAGTTGGCTTGAAAATGCCTACGCAGCAATTGCTGGTATCACATCACCATCTTGGCCTGTC
GATGATTTACTAGGATTTCCAGATTATGAGTCTAGTGACAAGGTAAAACAAACTTATTCCTTTTACATTTTGCAAGTACCCTATGTTTTC
GACTACTTGCGTGGCTGGGGAATTGATGTGTGGAGGACTTCTCTAGATGAXGAAGCTATCATTTTTCTTGGTAAAGCAGCTTATGCATTG
AACTTGAATTTGAAACACTTAAATATGCAAAACGACTTCCTTAGATTCCTCGATACATAN\
Edits in Original Sequence 
CAAGAGTTGAGTAATAAAAG(5')ATGAAGATCCAGTGTGATGTGTGTGAGAAAGCTCAAGCTACTGTGATTTGCTGTGCTGATGAGGCT
GCTTTGTGTGCAAAATGTGATATTGAAGTTCATGCTGCTAATAAATTAGCAAGTAAGCATCAGAGGCTTCATCTTCAGTGCCTATCTAAC
AAGCTTCCTCCTTGTGATATTTGCCAAGATAAAGCAGCCTTCATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCAAGGACTGTGACGAA
GCAATTCATTCAGCCAGCAGCCTCGCCAAGAACCACCAACGCTTCTTAGCCACTGGAATCCGTGTAGCCTTGAGCTCAAGCTGCAATAAG
GAAGCAGXTAAAAAACCAACTGGAGCCACAACCACCTCAGCAGAATTCTCAACAAGTTGGCTTGAAAATGCCTACGCAGCAATTGtCTGG
TATCACATCACCATCTTGGCCTGTCGATGATTTACTAGGATTTCCAGATTATGAGTCTAGTGACAAGGTAAAACAAACTTATTCCTTTTA
CATTTTGCAAGTACCCTATGTTTTCGACTACTTGCGTGGCTGGGGAATTGATGTGTGGAGGACTTCTCTAGATGAXGAAGCTATCATTTT
TCTTGGTAAAGCAGCTTATGCATTGAACTTGAATTTGAAACACTTAAATATGCAAAACGACTTCCTTAGATTCCTCGATACATAN\(3')
GGAGACATTTTATAACACCATTACATGTATATATGAATTCAGTATTACCATGTAATTGTCTATTCATCTAATATGTAATGAATAACCTAT
ATGATTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan