ESTScan Details for Unigene SGN-U287396

Score 
529
Direction 
Reverse
Predicted Peptide Sequence 
MSHNGXRESSMMSYADQKTFFDYSSAVVESVRHSPTFCSEFRESMLDXLTFPLERNTSASSSFSEVRLVLSIVLPSTLRXKLNGLFPCDI
ILVILLKXLIELPGCLLLKSKKKTEHKFEKIGKSVQYAAEVTAYVEPNKIKKLTGVKAKELLMWLTLNEICVDEPSTGKIHFKTPTGLSR
TFPVAAFELNEPKKEVKEVSAVVVAAVEVKEV
Predicted Coding Sequence 
ATGTCACACAATGGTGXTAGAGAGAGTTCAATGATGTCATATGCTGATCAAAAGACATTCTTCGACTATTCTTCTGCTGTGGTTGAGTCA
GTCCGGCACTCACCAACATTTTGTTCAGAGTTTCGGGAGAGCATGCTTGATXACTTGACTTTCCCATTAGAGAGAAATACCTCAGCAAGT
TCAAGTTTCTCTGAAGTGAGGCTAGTGCTGTCCATTGTCTTACCAAGCACTTTAAGAGXCAAGTTGAACGGCCTCTTCCCTTGTGATATC
ATCCTTGTAATCCTGCTTAAGAAXTTGATTGAGCTGCCTGGTTGTTTGCTCCTCAAATCCAAGAAAAAAACAGAACACAAGTTTGAAAAA
ATTGGTAAATCAGTCCAATATGCAGCTGAAGTCACTGCCTATGTTGAGCCCAATAAGATCAAGAAACTTACTGGGGTTAAAGCTAAAGAG
CTACTTATGTGGCTAACACTAAATGAAATATGTGTTGATGAGCCATCTACTGGTAAAATCCATTTCAAGACCCCAACTGGGCTTTCTAGG
ACTTTTCCTGTTGCAGCCTTTGAACTTAATGAGCCCAAAAAGGAAGTCAAAGAAGTGAGTGCTGTTGTTGTTGCTGCTGTGGAAGTGAAA
GAGGTGTAA\
Edits in Original Sequence 
CTTTAGTTTTTAGTACAAC(5')ATGTCACACAATGGTGXTAGAGAGAGTTCAATGATGTCATATGCTaGATCAAAAGACATTCTTCGAC
TATTCTTCTGCTGTaGGTTGAGTCAGTCCGGCACTCACCAACATTTTGTTCAGAGTTTCGGGAGAGCATGCTTGATXACTTGACTTTCCC
ATTAGAGAGAAATACCTCAGCAAGTTCAAGTTTCTCTGAAGTGAGGCTAGTGCTGTCCATTGTCTTACCAAGCACTTTAAGAGXCAAGTT
GAACGGCCTCTTCCCTTGTGATATCATCCTTGTAATCCTGCTTAAGAAXTTGATTGAGCTGCCTGGTTGTTTGCTCCTCAAATCCAAGAA
AAAAACAGAACACAAGTTTGAAAAAATTGGTAAATCAGTCCAATATGCAGCTGAAGTCACTGCCTATGTTGAGCCCAATAAGATCAAGAA
ACTTACTGGGGTTAAAGCTAAAGAGCTACTTATGTGGCTAACACTAAATGAAATATGTGTTGATGAGCCATCTACTGGTAAAATCCATTT
CAAGACCCCAACTGGGCTTTCTAGGACTTTTCCTGTTGCAGCCTTTGAACTTAATGAGCCCAAAAAGGAAGTCAAAGAAGTGAGTGCTGT
TGTTGTTGCTGCTGTGGAAGTGAAAGAGGTGTAA\(3')GAAGAAAAAAAAACAATATAATTTGTTTGCCTTAGTATAATCTAATCTTTA
CTTATTTTATTAAACTTTGATTAAAAAGTTATTGTACTACTACTACTACTTAAGTTGAGGATGGTGATTATCTAATCCATCTTATTGTAC
CCATCATCAAGTGGCTAATTATNGTCATCTTTTATTTGAATTTAGTGACATTATTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan