ESTScan Details for Unigene SGN-U287407

Score 
429
Direction 
Reverse
Predicted Peptide Sequence 
PGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGAAPGGMPGAAPGGMPGNMDYSKILNDPELMAAFKDPDVMAALQDVMKNPANLAKHQG
NPKIAPIIAKMMGKFAGNN
Predicted Coding Sequence 
XTGCCTGGTTTTCCTGGTGGCATGCCCGGAGGTTTTCCTGGTGGCATGCCTGGAGGCTTTCCAGGTGGCATGCCCGGAGGCTTTCCAGGG
GGAATGCCCGGGGCTGCACCTGGAGGAATGCCTGGGGCCGCACCCGGAGGAATGCCCGGTAACATGGACTACAGCAAAATACTGAATGAC
CCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGATGTGATGAAGAACCCAGCTAATTTGGCCAAGCATCAA
GGAAATCCTAAGATTGCTCCTATTATTGCGAAAATGATGGGCAAATTTGCTGGAAATAATTGA\
Edits in Original Sequence 
(5')XTGCCTGGTTTTCCTGGTGGCATGCCCGGAGGTTTTCCTGGTGGCATGCCTGGAGGCTTTCCAGGTGGCATGCCCGGAGGCTTTCC
AGGGGGAATGCCCGGGGCTGCACCTGGAGGAATGCCTGGGGCCGCACCCGGAGGAATGCCCGGTAACATGGACTACAGCAAAATACTGAA
TGACCCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGATGTGATGAAGAACCCAGCTAATTTGGCCAAGCA
TCAAGGAAATCCTAAGATTGCTCCTATTATTGCGAAAATGATGGGCAAATTTGCTGGAAATAATTGA\(3')GAGCTTTTGGGATTTTGT
CAGTAGGAATTTCTAGAGTTTGATAGAGAACATGTTATTTATCGTAAGCTTGGTTTTATCGAGTATAAAGTCATTCCCCAAGATTATGTC
AAATCCAAGTTTAGGTTCAAACTAGCTGTCTTTCTTTTTTATAGATTTGTTATTGTTAAGTTAAATGTATCAACTATTTTCCCTACTGGT
GAATGGTGTTATGCTATACAAAAACTGCCTTCTATTTCAAAAAAAAAAAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan