ESTScan Details for Unigene SGN-U287520

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
VASAXLEKPFPNVGLQNRKSHLPNVAEGDPSKNVNRPVACLLPRHLMKDPLAQNDAYERSLDNALKFADLVEKHNDEIAALENMGNGKPY
LQAAQAEVPSFVRYFRYYAGWADKNSCLTVPADGPHHI
Predicted Coding Sequence 
XTTGTTGCTTCTGCCXTCTTGGAAAAACCTTTCCCCAACGTTGGACTCCAAAACCGGAAAAGTCATTTGCCAAATGTTGCTGAAGGTGAT
CCTTCGAAAAATGTTAATCGCCCTGTGGCTTGCTTGCTTCCAAGGCATTTGATGAAGGACCCATTGGCCCAAAATGATGCTTATGAAAGG
TCACTTGATAATGCXCTAAAGTTTGCTGATTTGGTGGAGAAACACAATGATGAAATTGCAGCTTTAGAAAACATGGGAAATGGCAAGCCA
TATTTGCAGGCTGCCCAAGCTGAAGTACCTTCTTTTGTGCGATATTTTCGGTATTATGCTGGTTGGGCGGATAAAAATTCATGTCTAACT
GTACCAGCTGATGGGCCACACCATATA\
Edits in Original Sequence 
(5')XTTGTTGCTTCTGCCXTCTTGGAAAAACCTTTCCCCAACGTTGGACTCCAAAACCGGAAAAGTCATTTGCCAAATGTTGCTGAAGG
TGATCCTTCGAAAAATGTTAATCGCCCTGTGGCTTGCTTGCTTCCAAGGCATTTGATGAAGGACCCATTGGCCCAAAATGaATGCTTATG
AAAGGTCACTTGATAATGCXCTAAAGTTTGCTGATTTGGTGGAGAAACACAATGATGAAATTGCAGCTTTAGAAAACATGGGAtAATGGC
AAGCCATATTTGCAGGCTGCCCAAGCTGAAGTACCTTCTTTTGTGCGATATTTTCGGTATTATGCTGGTTGGGCGGATAAAAATTCATGT
CTAACTGTACCAGCTGATGGGCCACACCATATA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan