ESTScan Details for Unigene SGN-U287532

Score 
129
Direction 
Forward
Predicted Peptide Sequence 
MLPLKFAIAVFLVVLIGNSVVAEDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVIKSTTAWMNLFYFPGN
Predicted Coding Sequence 
ATGTTGCCGCTAAAATTCGCCATAGCGGTGTTTTTAGTGGTATTAATTGGGAATTCTGTTGTAGCAGAAGATCCTTATAGATACTTCGAT
TGGAATGTTACTTATGGAACTATTTATCCTCTCGGAGTTCCTCAACAGGGAATTCTGATTAATGGCCAGTTTCCCGGTCCTGATATCAAC
TCGGTCACCAATGACAATCTCGTTATCAAATCCACAACAGCTTGGATGAACCTTTTCTACTTTCCTGGTAATTAA\
Edits in Original Sequence 
AAGTAGAAAAAA(5')ATGTTGCCGCTAAAATTCGCCATAGCGGTGTTTTTAGTGGTATTAATTGGGAATTCTGTTGTAGCAGAAGATCC
TTATAGATACTTCGATTGGAATGTTACTTATGGAACTATTTATCCTCTCGGAGTTCCTCAACAGGGAATTCTGATTAATGGCCAGTTTCC
CGGTCCTGATATCAACTCGGTCACCAATGACAATCTCGTTATCAAtATCCACAACAGCTTGGATGAACCTTTTCTACTTTCCTGGTAATT
AA\(3')CTTAAACTTCCATTTTTTTGTTCACATTAGTGCGTTGATTACGTTGAAGATCACTTATCACATTTGATAGACTCGTGATAAAT
TTAACTGTATCAATTTCTGAACAAACAAGGATAGCTACATAGGAATAAATTTTGGGTAATTTGCAGTTTGTTTCTGGGTTATACAGTTCG
CAAGTGCATTGATTTGGGCAGATTGTATTTAAGTATCTGTCTGGTTAATATGGTTCTGCAGGCAGTCAGATCTCACTATAATAAGTGATT
TAAGGCAAGTTTTGTGCTCTGAACAATTATAGTGAAAAAATTTAAAATGTATGCAGTTAATAAGATAAAAATATTTTAAACAAACTGGCT
CTGGATCATGAATTCGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan