ESTScan Details for Unigene SGN-U287726

Score 
389
Direction 
Reverse
Predicted Peptide Sequence 
VNYINAHATSTIVGDLAEVNAIKKVFKNTSEIKMNATKSMIGHCLGAAGGLEAIATVKAIKTGWLHPSINQFNTEPSVEFDTVPNKKQQH
EINVAISNSFGFGGHNSVVVFSDFKP
Predicted Coding Sequence 
GTTAATTACATAAATGCTCATGCAACTTCCACAATAGTTGGTGATCTAGCGGAGGTAAATGCTATTAAGAAGGTATTCAAGAACACTTCA
GAGATCAAAATGAATGCAACCAAGTCCATGATAGGCCACTGCCTGGGTGCTGCTGGTGGCCTGGAAGCTATTGCAACAGTTAAAGCCATT
AAAACTGGCTGGCTGCATCCTTCCATAAACCAATTCAATACTGAGCCTTCAGTTGAGTTTGATACCGTTCCAAACAAGAAACAGCAGCAC
GAGATCAATGTTGCAATCTCAAATTCATTTGGTTTTGGTGGTCACAACTCTGTTGTCGTGTTTTCTGACTTCAAGCCCTAA\
Edits in Original Sequence 
(5')GTTAATTACATAAATGCTCATGCAACTTCCACAATAGTTGGTGATCTAGCGGAGGTAAATGCTATTAAGAAGGTATTCAAGAACAC
TTCAGAGATCAAAATGAATGCAACCAAGTCCATGATAGGCCACTGCCTGGGTGCTGCTGGTGGCCTGGAAGCTATTGCAACAGTTAAAGC
CATTAAAACTGGCTGGCTGCATCCTTCCATAAACCAATTCAATACTGAGCCTTCAGTTGAGTTTGATACCGTTCCAAACAAGAAACAGCA
GCACGAGATCAATGTTGCAATCTCAAATTCATTTGGTTTTGGTGGTCACAACTCTGTTGTCGTGTTTTCTGACTTCAAGCCCTAA\(3')
GTCAGCTTAGTATAGCAAGAGCAACCTTCTGCTTCTGAGGCTTAATTTAGTGTGGTATAGAGAGGCTGCTTCATCTCAACATAGCAATTG
CGAATTTTGGTTGTTTTTGTTCTTTGCAACGACAATCTTAACTTTTTCTGGTATTTTTCCACCTTTAGATAATTGGATGTTTTCAGGCTT
GGTTAGGCAGCAACCAGTTTTGAAATATGTAAAAGATAGAAAATACACTATGGTATTTTGAGGTTGAGAACATTGTTAACACTTTGNTAA
AAAAAGGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan