Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U287762

Score 
354
Direction 
Forward
Predicted Peptide Sequence 
MAKSPQEEHPIKAFGWALXDTSGVLTPFNFSRRATGEKDVQSKILPWGVCHTDLHFLNNEWGVTRYPVVPGHEIVGAVT
Predicted Coding Sequence 
ATGGCAAAATCCCCACAAGAAGAACATCCAATTAAGGCTTTTGGATGGGCTCTTGAXGATACTTCTGGTGTTCTTACTCCTTTCAACTTC
TCAAGACGGGCTACTGGGGAGAAAGATGTGCAATCCAAGATCTTGCCTTGGGGAGTTTGCCACACAGATCTTCACTTTCTCAATAATGAA
TGGGGAGTCACCAGATATCCTGTTGTACCTGGGCATGAAATTGTGGGTGCTGTGACCTAA\
Edits in Original Sequence 
CATTATTGTATATATCTAGCTATTTTCTCTGGGTTGGGTGCTTTTATTTAGTTGGTTGAA(5')ATGGCAAAATCCCCACAAGAAGAACA
TCCAATTAAGGCTTTTGGATGGGCaTCTTGAXGATACTTCTGGTGTTCTTACTCCTTTCAACTTCTCAAGACGGGCTACTGGGGAGAAAG
ATGTGCAATCCAAGATCTTGCCTTGGGGAGTTTGCCACACAGATCTTCACTTTCTCAATAATGAATGGGGAGTCACCAGATATCCTGTTG
TACCTGGGCATGAAATTGTGGGTGCTGTGACCTAA\(3')GCCGGTAACAAAGTTGATTAATTTACGATTGGTGACAAAATAGGTGTTGG
ATGTCTAGTAGGATCATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan