ESTScan Details for Unigene SGN-U287766

Score 
383
Direction 
Reverse
Predicted Peptide Sequence 
YVNSPKAFKGWMKKNMRDLFKXWYAVNENELLSRLXPEPDRAIGLSPHSDADALTILFQLNETEGLQVRKDDIWVPIKALPNALIVNIGD
MMEIVSNGVYRSIEHRATVNSNEERLSVATFYNINLESELGPAHSLIGPHNPPIFRRVSVHKYLQDFFARKLDGKSYLDFMKVEARDDES
Predicted Coding Sequence 
XXGTATGTCAATTCGCCAAAGGCCTTTAAAGGATGGATGAAAAAGAATATGCGAGATCTATTCAAGTGATGGTATGCAGTCAATGAGAAT
GAATTATTATCCCGCCTTGXTCCTGAGCCAGACAGGGCAATTGGCTTAAGCCCTCATTCTGATGCGGATGCCCTCACCATCCTCTTCCAG
CTCAATGAAACTGAAGGTCTCCAAGTCAGAAAAGACGATATTTGGGTGCCTATAAAGGCCCTCCCAAATGCTTTGATTGTCAATATTGGC
GATATGATGGAGATAGTGAGCAATGGTGTCTATAGAAGCATTGAGCATAGAGCAACTGTAAACTCAAATGAAGAACGACTCTCTGTTGCG
ACATTCTATAACATCAACCTTGAGTCCGAGTTAGGACCTGCACACAGCCTCATTGGACCACATAATCCTCCCATTTTCCGAAGAGTTTCT
GTGCACAAATATTTACAGGACTTTTTTGCACGAAAACTTGATGGAAAATCGTACCTTGATTTCATGAAGGTCGAGGCAAGGGATGATGAA
TCATAG\
Edits in Original Sequence 
(5')XXGTATGTCAATTCGCCAAAGGCCTTTAAAGGATGGATGAAAAAGAATATGCGAGATCTATTCAAGTGATGGTATGCAGTCAATGA
GAATGAATTATTATCCCGCCTTGXTCCTGAGCCAGACAGGGCAATTGGCTTAAGCCCTCATTCTGATGCGGATGCCCTCACCATCCTCTT
CCAGCTCAATGAAACTGAAGGTCTCCAAGTCAGAAAAGACGATATTTGGGTGCCTATAAAGGCCCTCCCAAATGCTTTGATTGTCAATAT
TGGCGATATGATGGAGATAGTGAGCAATGGTGTCTATAGAAGCATTGAGCATAGAGCAACTGTAAACTCAAATGAAGAACGACTCTCTGT
TGCGACATTCTATAACATCAACCTTGAGTCCGAGTTAGGACCTGCACACAGCCTCATTGGACCACATAATCCTCCCATTTTCCGAAGAGT
TTCTGTGCACAAATATTTACAGGACTTTTTTGCACGAAAACTTGATGGAAAATCGTACCTTGATTTCATGAAGGTCGAGGCAAGGGATGA
TGAATCATAG\(3')GTAGCATTTGATATAAGTTACTCTTGCTGTTGTAATTTAGAGTTCCCTGTTTGATTACTATAAATAAGAAGAATA
GAGTACTCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan