ESTScan Details for Unigene SGN-U287788

Score 
48
Direction 
Reverse
Predicted Peptide Sequence 
FPPMKTFGTVADQSTQPVQPGSHFHPLLERRRKISLSLFDQTNKTKLNWLNXKIKTTVIANQKQRPYFQNLTQQLESSTKLRQQILDANA
EGTIRLAEDPTGFPETISLALASDIFNRFAFRT
Predicted Coding Sequence 
XXCTTTCCGCCTATGAAGACGTTTGGCACAGTTGCTGACCAGTCCACTCAGCCAGTGCAGCCTGGATCTCACTTCCATCCTCTGTTAGAA
CGAAGGCGAAAGATCTCGTTATCTCTATTTGATCAAACAAACAAAACAAAACTGAATTGGCTTAATXTAAAGATCAAAACAACTGTAATT
GCTAATCAGAAACAGAGGCCTTACTTTCAGAATCTAACTCAACAGCTTGAAAGTAGCACCAAGCTTCGACAACAAATCCTTGACGCTAAC
GCAGAAGGGACAATACGTCTTGCTGAAGACCCAACTGGATTTCCAGAAACGATTTCCTTAGCTTTGGCAAGTGACATCTTCAATCGATTT
GCTTTTCGAACX\
Edits in Original Sequence 
(5')XXCTTTCCGCCTATGAAGACGTTTGGCACAGTTcGCTGACCAGTCCACTCAGCCAGTGCAGCCTGGATCTCACTTCCATCCTCTGT
TAGAACGAAGGCGAAtAGATCTCGTTATCTCTATTTGATCAAACAAACAAAACAAAACTGAATTGGCTTAATXTAAAGATCAAAACAACT
GTAATTGCTAATCAGAAACAGAGGCCTTACTTTCAGAATCTAACTCAACAGcCTTGAAAGTAGCACCAAGCTTCGACAACAAATCCTTGA
CGCTAACGCAGAAGGGACAATACGTCTTGCTGAAGACCgCAACTGGATTTCCAGAAACGATTTCCTTAGCTTTGGCAAGTGACATCTTCA
ATCGATTTGCTTTTCGAACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan