ESTScan Details for Unigene SGN-U287797

Score 
263
Direction 
Forward
Predicted Peptide Sequence 
MTTSRRLADRKVERFEKNITKRGAVPETTAKKGSQYPVGPXLAWVLRLCCHWLM
Predicted Coding Sequence 
ATGACTACATCAAGGCGTCTTGCTGATAGGAAGGTGGAGAGGTTTGAGAAAAATATTACCAAGCGAGGAGCTGTTCCTGAAACTACTGCA
AAGAAGGGAAGCCAGTATCCAGTTGGCCCTXATCTTGCTTGGGTTCTTCGTCTTTGTTGTCATTGGCTCATGTAA\
Edits in Original Sequence 
ATTTCCCTTCAAAAA(5')ATGACTACATCAAGGCGTCTTGCTGATAGGAAGGTGGAGAGGTTTGAGAAAAATATTACCAAGCGAGGAGC
TGTTCCTGAAACTACTGCAAAGAAGGGAAGCCAGTATCCAGTTGGCCCTXATCTTGCTTGGGTTCTTCGTCTTTGTTGTCATTGGCTCAT
GTAA\(3')GATCTCTGTGTATCTTTTTGTCTCCTATTTTTTGCCTCTTGATATCTGAGGCATTATACTAGAAGTATCTAAACTCTACTT
TTATCTTAAAAGACAAGTAACAAGAACATCAATATATATTGCCCACCATTATAGAATCTTAATAGGGTTGTATGCATAAATATTTAACAA
TGTATATCAGCTGCTAGCAATGGATTAGATAGGTTAGCCTTTCTTCTTTCGGAAAAAACTTTTGTGTGATCTTTGAGAGATTGTTGTCTT
TTCTCATTCATGTACACACATACAATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan