ESTScan Details for Unigene SGN-U287813

Score 
90
Direction 
Reverse
Predicted Peptide Sequence 
SELQPFVESLSKCPKHGLHNPFKAPERYLMLGDVSTKAAHALGLPEVSDFFAKLINGCLIRACW
Predicted Coding Sequence 
TCAGAATTGCAGCCGTTTGTGGAGAGCTTGTCCAAGTGCCCGAAACATGGTCTACATAATCCATTCAAAGCACCAGAAAGGTACTTAATG
TTAGGAGACGTATCTACAAAAGCAGCTCATGCGCTTGGCTTGCCTGAGGTTTCTGATTTCTTTGCTAAGCTAATCAACGGGTGTCTCATA
AGAGCTTGTTGG\
Edits in Original Sequence 
(5')TCAGAATTGCAGCCGTTTGTGGAGAGCTTGTCCAAGTGCCCGAAACATGGTCTACATAATCCATTCAAAGCACCAGAAAGGTACTT
AATGTTAGGAGACGTATCTACAAAAGCAGCTCATGCGCTTGGCTTGCCTGAGGTTTCTGATTTCTTTGCTAAGCTAATaCAACGGGTGTC
TCATAAGAGCTTGTTGG\(3')TAACTCTTAGGAGACACCCGTTGTATTAGCTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan