ESTScan Details for Unigene SGN-U287863

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
MALGGGTQKGTASTAAAXPTSKKNGDSGAAEEQWYHAPFYTDDSPGLKISPNVVLVMSIGSYLCRNPSLMGKLYFVRKRAKTFNISLLSW
EIFVGQQLSSLKEKLTL
Predicted Coding Sequence 
ATGGCTTTGGGTGGAGGGACACAAAAGGGGACTGCAAGCACAGCAGCTGCTAAXCCTACGTCGAAGAAGAACGGAGACAGTGGAGCTGCA
GAGGAGCAGTGGTACCATGCTCCATTCTACACTGATGATTCCCCTGGACTAAAGATATCCCCCAATGTTGTGCTTGTGATGAGTATTGGT
TCATACCTTTGTCGCAATCCTTCACTCATGGGTAAGCTCTACTTTGTCCGCAAGAGGGCTAAGACATTCAATATCTCATTGTTGAGTTGG
GAAATTTTTGTTGGGCAACAGCTTTCTTCGTTGAAGGAAAAACTGACATTGTAG\
Edits in Original Sequence 
GGAGAATCATTTTCCTAATTCTCAGCATTTTTAATGACTAAA(5')ATGGCTTTGGGTGGAGtGGACACAAAAGGGGACTGCAAGCACAG
CAGCTGCTAAXCCTACGTCGAAGAAGAACGGAGACAGTGGAGCTGCAGAGGAGCAGTGGTACCATGCTCCaATTCTACACTGATGATTCC
CCTGGACTAAAGATATCCCCCAATGTTGTGCTTGTGATGAGTATTGGTTCATACCTTTGTCGCAATCCTTCACgTCATGGGTAAGCTCTA
CTTTGTCCGCAAGAGGGCTAAGACATTCAATATCTCATTGTTGAGTTGGGAAATTTTTGTTGGGCAACAGCTTTCTTCGTTGAAGGAAAA
ACTGACATTGTAG\(3')CTTTATTTTCTTGTTTGTTTTCTATGCAATGAAGTTTATAAAAAGCTTTCTATTATGATTGAATGTTTCTTT
GTTGCTACCTGTTGTTCTGATATCTTATAAAAGAAGGGTGGCAAATTCTAGTTTCTTAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan