ESTScan Details for Unigene SGN-U287890

Score 
231
Direction 
Reverse
Predicted Peptide Sequence 
MXQDTVPQAMHVLLPEMLKTCLCVPPGFYGNKGVCPCYNIWKTKEGGPKCP
Predicted Coding Sequence 
ATGTAGCAAGACACAGTACCACAAGCCATGCATGTTCTTTTGCCAGAAATGCTGAAGACATGCCTATGTGTTCCTCCTGGTTTCTATGGA
AACAAAGGTGTTTGCCCATGCTACAACATTTGGAAGACCAAAGAAGGGGGACCAAAATGCCCTTAA\
Edits in Original Sequence 
TCAGCATGACTTTTGAATTTCTATATAACTTTAAGATATATTCCTTAGCTTATGAATACACTTGTGTGCTTCAGAAGGTACTTTATTCCT
ACAAACTTTGTCATGAAGTAGTTTTAATTTTATTTTTTTATGCATATGAAACATTTTGTATTTTATAACGTTTGATAATGCATGCATTTT
AGAAGTGTAACCGTAACTTTAATTTTGAATGCGTAAAATTTATGTTAGTCAGGGACTTTGTAATATATCAGATACTATTAATGTGAAATT
GCTATCAGCCTGCCACAATGTACAAGAAG
(5')ATGTAGCAAGACACAGTACCACAAGCCATGCATGTTCTTTTGCCAGAAATGCTGtAA
GACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCATGCTACAACATTTGGAAGACCAAAGAAGGGGGACCAAA
ATGCCCTTAA\(3')TTATTTAACCACATTGCTACTCTAAATTTGTCACGCCAAAGTTTAATTGATATTGTTGTTTATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan