ESTScan Details for Unigene SGN-U287957

Score 
365
Direction 
Reverse
Predicted Peptide Sequence 
IIHRDIKSSNILLDDEFQPKIADFGLVRLLPGDQSHVSTKFAGTLGYTAPEYAIHGHLTEKVDVYGFGVVVLEIISGRRSNHMQETEYLL
EQAWKFHEAGMHVKLVDETLDVSEYNEQEVKKIIEIALMCTQSPPSLRPSMSEIVVMLLSDRSTDRRTPSRPNFVSMDTITIANSSMTTG
SSASNATNTFTDITGPSYIRVYCRDENYVTL
Predicted Coding Sequence 
XGCATCATCCATAGAGATATAAAATCCAGTAACATTCTACTAGACGATGAATTCCAGCCAAAAATTGCAGATTTTGGGCTNGTAAGACTT
TTACCTGGGGATCAGAGTCATGTCAGCACTAAATTTGCTGGTACCTTGGGATATACTGCGCCAGAATATGCAATTCATGGACATCTAACA
GAGAAGGTTGACGTCTATGGCTTTGGTGTTGTTGTTCTTGAAATAATCAGTGGACGGAGGAGCAATCATATGCAAGAAACTGAATATCTC
CTTGAACAGGCGTGGAAATTTCACGAAGCTGGCATGCATGTAAAACTGGTGGATGAAACTTTAGATGTCAGTGAATACAACGAACAAGAA
GTGAAGAAAATCATAGAGATTGCCTTAATGTGTACACAATCACCTCCAAGTCTTAGGCCAAGCATGTCTGAAATTGTTGTCATGCTATTA
AGTGATCGTAGCACAGACAGGAGAACTCCTAGCAGGCCTAATTTCGTTAGCATGGATACGATAACAATCGCGAACTCATCCATGACTACT
GGATCATCAGCTTCTAATGCAACCAACACTTTTACTGATATCACTGGCCCTAGCTACATAAGAGTTTACTGTAGAGATGAAAATTATGTG
ACACTCTAA\
Edits in Original Sequence 
(5')XGCATCATCCATAGAGATATAAAATCCAGTAACATTCTACTAGACGATGAATTCCAGCCAAAAATTGCAGATTTTGGGCTNGTAAG
ACTTTTACCTGGGGATCAGAGTCATGTCAGCACTAAATTTGCTGGTACCTTGGGATATACTGCGCCAGAATATGCAATTCATGGACATCT
AACAGAGAAGGTTGACGTCTATGGCTTTGGTGTTGTTGTTCTTGAAATAATCAGTGGACGGAGGAGCAATCATATGCAAGAAACTGAATA
TCTCCTTGAACAGGCGTGGAAATTTCACGAAGCTGGCATGCATGTAAAACTGGTGGATGAAACTTTAGATGTCAGTGAATACAACGAACA
AGAAGTGAAGAAAATCATAGAGATTGCCTTAATGTGTACACAATCACCTCCAAGTCTTAGGCCAAGCATGTCTGAAATTGTTGTCATGCT
ATTAAGTGATCGTAGCACAGACAGGAGAACTCCTAGCAGGCCTAATTTCGTTAGCATGGATACGATAACAATCGCGAACTCATCCATGAC
TACTGGATCATCAGCTTCTAATGCAACCAACACTTTTACTGATATCACTGGCCgCTAGCTACATAAGAGTTTACTGTAGAGATGAAAATT
ATGTGACACTCTAA\(3')AAAGATTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan