ESTScan Details for Unigene SGN-U288091

Score 
356
Direction 
Forward
Predicted Peptide Sequence 
MAFFDIPTIDVSGVFSSEENEKRKNTATDQMKQACVNYGFFHIANHEIPLELLSTTMDMYKTFFASSDEEKLSVPNNYVKSTHNPSETYE
HFAFHLSYSVFNVCPKNPPHFKELX
Predicted Coding Sequence 
ATGGCTTTTTTTGACATTCCAACAATTGATGTTTCTGGTGTTTTTAGTTCAGAGGAAAATGAAAAACGAAAAAATACGGCTACTGATCAA
ATGAAACAAGCTTGTGTTAACTATGGTTTTTTCCACATTGCGAATCACGAAATTCCTTTGGAGTTGTTGAGCACAACGATGGATATGTAT
AAGACTTTCTTTGCTTCTTCAGATGAAGAAAAATTGTCAGTACCTAATAATTATGTCAAAAGCACACATAATCCATCTGAGACTTATGAG
CACTTTGCGTTTCATCTTTCATACTCTGTCTTCAATGTCTGCCCCAAAAATCCACCTCATTTCAAGGAATTATTX\
Edits in Original Sequence 
AGACATC(5')ATGGCTTTTTTTGACATTCCAACAATTGATGTTTCTcGGTGTTTTTAGTTCAGAGGAAAATGAAAAACGAAAAAATACG
GCTACTGATCAAATGAAACAAGCTTGTGTTAACTATGGTTTTTTCCACATTGCGAATCACGAAATTCCTTTGGAGTTGTTGAGCACAACG
ATGGATATGTATAAGACTTTCTTTGCTTCTTCAGATGAAGAAAAATTGTCAGTACCTAATAATTATGTCAAAAGCACACATAATCCATCT
GAGACTTATGAGCACTTTGCGTTTCATCTTTCATACTCTGTCTTCAATGTCTGCCCCAAAAATCCACCTCATTTCAAGGAATTATTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan