ESTScan Details for Unigene SGN-U288163

Score 
256
Direction 
Forward
Predicted Peptide Sequence 
GRAGRFGTKGLAITFVSSASDSDVLNQVQQRFEVDIKELPEQIXYFHIHAIKWSEVFLENIQVKLHEDKGSQ
Predicted Coding Sequence 
XXGGGTAGAGCTGGTAGGTTTGGAACTAAAGGCCTTGCCATCACATTTGTCTCGTCTGCATCAGATTCTGATGTTCTTAATCAGGTTCAG
CAGAGGTTTGAAGTGGATATTAAAGAGCTTCCTGAGCAGATTGAXTACTTCCACATACATGCCATCAAGTGGAGTGAGGTCTTCCTGGAA
AATATTCAGGTGAAGTTGCATGAAGATAAGGGTTCACAATAA\
Edits in Original Sequence 
(5')XXGGGTAGAGCTGGTAGGTTTGGAACTAAAGGCCTTGCCATCACATTTGTCTCGTCTGCATCAGATTCTGATGTTCTTAATCAGGT
TCAGCAGAGGTTTGAAGTGGATATTAAAGAGCTTCCTGAGCAGATTGAXTACTTCCACATACATGCCATCAtAGTGGAGTGAGGTCTTCC
TGGAAAATATTCAGGTGAAGTTGCATGAAGATAAGGGTTCACAATAA\(3')GGCGGTTATGCTTTTTTTGTTCAACAAACTGTCGGAAT
TTGATCCAATTAATTGGAAGAATGGGTAGCTGCCTCTGTTTCTGCACTTTTAGATTGATGTACCTATGGAATCCATACATGTTTTAATCA
GTTCGAGAACTCCAAATGTTAATGTAATCCTTTTAAGAACACAACTGATGTCCCTTCTGCTGCCTAGTTGCTAATGATTAATTCAGGCCA
GGTCCAGAGTACTAGTTGATGTTTACTTAAATTTGTTCACTTGAAGTTCAAGAACTATATTTGTGATGAGAAACTGTAAGCTGACAACTG
AAACTGAATCTGGAAACTCTGTTAATCTGGTAAGTATATATTTTTTTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan