Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U288214

Score 
239
Direction 
Reverse
Predicted Peptide Sequence 
MQDVYYTNSFIVTTKGLDLELPRVLTTNIIIDLSRNRFEGHIPSIIGDLVGLRTLNLSHNRLEGDVPASLHHLSVLESLDLHPTKSAEKF
HNNLHPSNHLKS
Predicted Coding Sequence 
ATGCAAGATGTTTATTACACAAATTCCTTTATAGTTACAACAAAGGGGCTGGATCTAGAACTACCTCGAGTTTTGACTACAAACATAATT
ATTGATCTCTCAAGGAATAGATTTGAAGGTCATATCCCAAGCATTATTGGAGATCTTGTTGGGCTTCGTACTTTGAACTTATCTCATAAT
CGCTTGGAAGGTGATGTACCAGCATCATTGCATCATTTATCTGTACTTGAATCATTGGATCTTCATCCAACAAAATCAGCGGAGAAATTC
CACAACAACTTGCATCCCTCAAATCACTTGAAGTCTTAA\
Edits in Original Sequence 
TTTTTTTTTGTTTTTTTTTTTTTAGCAGAT(5')ATGCAAGATGTTTATTACACAAATTCCTTTATAGTTACAACAAAGGGGCTGGATCT
AGAACTACCTCGAGTTTTGACTACAAACATAATTATTGATCTCTCAAGGAATAGATTTGAAGGTCATATCCCAAGCATTATTGGAGATCT
TGTTGGGCTTCGTACTTTGAACTTATCTCATAATCGCTTGGAAGGTGATGTACCAGCATCATTGCATCATTTATCTGTACTTGAATCATT
GGATCTcTCATCCAACAAAATCAGCGGAGAAATTCCACAACAACTTGCATCCCTCAAATCACTTGAAGTCTTAA\(3')ATCTCTCTCAC
AATCATCTTGTTGGATGAATCCCCAAAGGAAACCAATTTGATACGTTTGAGAATAGTTCATACCAAGGGAATTATGTCATTGAGAAAGTC
ATTGAACTTAGTTTTGTAGTTATGTAGAAAAGCTAGTTATGAAGAAATTATGTCTTTTTTTTGTAGTTCTTGTCCTCGTGCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan