ESTScan Details for Unigene SGN-U288254

Score 
478
Direction 
Forward
Predicted Peptide Sequence 
MAGMRLLPEDPDVAQVRPTAAADLISDDDRSVAADSWSIKSEYGSTLDDEQRHADATEALNYRADYSSDKDEQEGEGVSSMLGFQSYWDA
AYADELANFREHGHTGEVWFGGDVMENVVSWTKRLCMDICKNHLPNHVADADSEPVGQREKDMXGWSVLDIGTGNGLLLPELAKQGLMTF
L
Predicted Coding Sequence 
ATGGCCGGAATGAGACTGTTACCGGAGGACCCCGACGTCGCGCAGGTCCGACCAACGGCAGCAGCCGACCTGATTTCCGACGACGACCGC
TCTGTGGCGGCCGATTCTTGGTCCATAAAGAGCGAATACGGAAGTACTCTCGATGATGAGCAGCGCCACGCTGATGCTACTGAAGCTCTT
AATTACCGAGCCGATTACAGTTCTGACAAGGATGAGCAGGAAGGTGAAGGAGTTTCTTCAATGCTTGGTTTCCAAAGCTATTGGGATGCT
GCTTACGCTGATGAATTGGCAAACTTTCGTGAGCATGGTCACACTGGTGAAGTTTGGTTTGGTGGTGACGTCATGGAAAATGTTGTCTCT
TGGACCAAACGTTTGTGCATGGACATTTGCAAGAATCATTTGCCAAATCACGTAGCTGATGCCGATTCTGAGCCTGTTGGGCAGCGTGAG
AAGGACATGCANGGTTGGAGTGTGCTTGATATTGGGACTGGCAATGGTCTGCTTCTCCCAGAGCTTGCTAAACAAGGGTTGATGACATTC
TTG\
Edits in Original Sequence 
CTCAAACGTACATCACACTCCTCTCTCTCCCTTCCTCTTCTCCTTAGGGTTTTTCATCTCGATTCATCACAC(5')ATGGCCGGAATGAG
ACTGTTACCGGAGGACCCCGACGTCGCGCAGGTCCGACCAACGGCAGCAGCCGACCTGATTTCCGACGACGACCGCTCTGTGGCGGCCGA
TTCTTGGTCCATAAAGAGCGAATACGGAAGTACTCTCGATGATGAGCAGCGCCACGCTGATGCTACTGAAGCTCTTAATTACCGAGCCGA
TTACAGTTCTGACAAGGATGAGCAGGAAGGTGAAGGAGTTTCTTCAATGCTTGGTTTCCAAAGCTATTGGGATGCTGCTTACGCTGATGA
ATTGGCAAACTTTCGTGAGCATGGTCACACTGGTGAAGTTTGGTTTGGTGGTGACGTCATGGAAAATGTTGTCTCTTGGACCAAACGTTT
GTGCATGGACATTTGCAAGAATCATTTGCCAAATCACGTAGCTGATGCCGATTCTGAGCCTGTTGGGCAGCGTGAGAAGGACATGtCANG
GTTGGAGTGTGCTTGATATTGGGACTGGCAATGGTCTGCTTCTCCCAGAGCTTGCTAAACAAGGGTTGATGACATTCTTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan