ESTScan Details for Unigene SGN-U288783

Score 
320
Direction 
Reverse
Predicted Peptide Sequence 
HDPDGNMIEICNCQNLPVLPLSSCPLKKMSTPTFNQTISDSFYGNGKTNTKMNCAGEVESLMMENLALDMIDISF
Predicted Coding Sequence 
CATGACCCAGATGGCAACATGATTGAAATTTGCAATTGCCAAAATTTACCTGTTCTTCCACTTTCCTCTTGCCCACTCAAAAAGATGTCA
ACTCCAACTTTCAACCAAACAATATCAGATTCCTTTTATGGAAATGGAAAAACAAATACAAAGATGAATTGTGCTGGAGAAGTTGAATCT
CTTATGATGGAAAATTTAGCTTTGGATATGATAGACATTTCTTTTTGA\
Edits in Original Sequence 
(5')CATGACCCAGATGGCAACATGATTGAAATTTGCAATTGCCAAAATTTACCTGTTCTTCCACTTTCCTCTTGCCCACTCAAAAAGAT
GTCAACTCCAACTTTCAACCAAACAATATCAGATTCCTTTTATGGAAATGGAAAAACAAATACAAAGATGAATTGTGCTGGAGAAGTTGA
ATCTCTTATGATGGAAAATTTAGCTTTGGATATGATAGACATTTCTTTTTGA\(3')GTGATCTATGTGGAAGAAAAAAAAGAGTGATTT
TTGCTTCTCATTATTAGCCCCTTTTTTTTTACCAACCCAAATATACCATAAAAATTCCTTTTTGTAATATTATTATTATTATTATTATTA
TTATTATTATTATTATTATTATGTATTAGTATGTGTAGAGAGGTGTGATGAAGAGCATATATTATTATAAATATAATGTAAAATTGAGAT
TATGTTAATGCATGATAATAGCTACCCATGTCTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan