ESTScan Details for Unigene SGN-U288966

Score 
185
Direction 
Forward
Predicted Peptide Sequence 
QGSGTDPEDVAKIREALQTGSTYCGRLLNYKKDGTPFWNLLTIAPIKDDDGKVLKFIGXSKNELIS
Predicted Coding Sequence 
CAGGGTTCGGGTACGGATCCTGAGGATGTGGCTAAGATCCGAGAAGCATTGCAAACGGGTTCAACTTACTGTGGAAGATTACTAAATTAC
AAGAAGGATGGGACCCCTTTTTGGAATCTCCTCACCATTGCACCTATCAAAGATGATGATGGCAAAGTTCTCAAATTCATTGGGXTAAGT
AAAAATGAACTTATTTCGTAA\
Edits in Original Sequence 
(5')CAGGGTTCGGGTACGGATCCTGAGGATGTGGCTAAGATCCGAGAAGCATTGCAAACGGGTTCAACTTACTGTGGAAGATTACTAAA
TTACAAGAAGGATGGGACCCCTTTTTGGAATCTCCTCACCATTGCACCTATCAAAGATGATGATGGCAAAGTTCTCAAATTCATTGGGXT
AAGTAAAAATGAACTTATTTCGTAA\(3')AATCGATTACACGTTTAAATTATTGTGACAATCTATTACACATTTATTTTTATGTATTTA
CAAATATATGATACGAATAAGATTATTTATAATGATGCAATATTTATGATATTCACGTGGCAATTATATTTTTTTAAAATACACTATTAA
CTATTAAGTAGTGCATGAGATAATATATAGGTACTATCCAAAGTTTGAGATTGTTATAGCAATTTCGGTTAAAGTTCGAATATATTTTGA
ACTTTTTTCCATTATTTAACTACCTACTATTCTGTTAAATTAAAGGTATATAAACTAAACGAGTACATAAGTACCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan