ESTScan Details for Unigene SGN-U289048

Score 
172
Direction 
Reverse
Predicted Peptide Sequence 
IRDDXLLLSNKDIRSHIAQICVEKFLGFGSQVFIGMNKKDRPXNAGVVRELEDITYMLPAVFDNNIAPDTDVSTSGMSSSPPTSTYSRHT
TTYTTMEGIELVTVSFPPSGLVDAFKDLLYTSIYQHVNGQIVKY
Predicted Coding Sequence 
XXAATCAGGGATGATGXTCTTCTATTATCGAACAAGGATATAAGGTCCCATATTGCTCAGATTTGTGTCGAGAAATTCCTGGGATTTGGC
TCTCAGGTGTTCATTGGGATGAACAAAAAGGATAGACCTTTXAATGCTGGAGTGGTGAGAGAGTTAGAGGACATCACATACATGCTTCCA
GCTGTATTCGACAATAATATTGCACCAGATACAGATGTTTCCACGTCTGGAATGTCATCATCACCACCAACTTCAACTTATTCCAGACAC
ACTACCACCTACACAACTATGGAAGGAATTGAGCTTGTGACGGTGTCATTCCCACCATCAGGCCTCGTTGATGCGTTTAAGGACTTGCTA
TATACTTCCATTTACCAACATGTTAATGGTCAGATTGTGAAGTATTAG\
Edits in Original Sequence 
(5')XXAATCAGGGATGATGXTCTTCTATTATCGAACAAGGATATAAGGTCCCATATTcGCTCAGATTTGTGTCGAGAAATTCCTGGGAT
TTGGCTCTCAGGTGTTCATTGGGATGAACAAAAAGGATAGACCTTTXAATGCTGGAGTGGTGAGAGAGTTAGAGGACATCACATACATGC
TTCCAGCTGTATTCGACAATAATATTGCACCAGATACAGATGTTTCCACGTCTGGAATGTCATCATCACCACCAACTTCAACTTATTCCA
GACACACTACCACCTACACAACTATGGAAGGAATTGAGCTTGTGAgCGGTGTCATTCCCACCATCAGGCCTCGTTGATGCGTTTAAGGAC
TTGCTATATACTTCCATTTACCAACATGTTAATGGTCAGATTGTGAAGTATTAG\(3')AAGTTTCACATTTTAATCTGAGGTATGTAAA
TATATATATAAGCAGGTTGAATCAACTCTGAGAGCATGAAAAGACTTGTATATAATCATATGATGATGTTGTTGTTCCATTAGAATGCAC
TCTTGTTTATGACCATAATAGGTGATGAGTTAATGGAATATACCGTCAGTGTAAACAATTTTTACATCATCAGGTCATTTTTACTTTTTG
TCAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan