ESTScan Details for Unigene SGN-U289060

Score 
593
Direction 
Forward
Predicted Peptide Sequence 
MSALLSSTPFSAIFAPSELTRLPSSSSIEASTEFLDSVSIRFQIGNFSFLKSPVLLNNALQDQSENPSCSQDSLFYSRAFWVTKSIIAWN
VCAGEGECYLYASRKAGLCVTDDGIQGHDVKIKLERTNYGLPXAAFEVPATLDFQSLIKCQLAVGIFNSYGKCASATGLQLPGILDELFS
YTGPLGAVFATEAVSLYLWAPTAQAVQALIYKSPSEADPVEIVQLKELDGVWSAKGQSIGRVAT
Predicted Coding Sequence 
ATGTCTGCTTTACTTTCATCCACTCCATTTTCCGCCATTTTCGCACCTTCCGAGCTCACTCGXCTTCCTTCTTCCAGCTCAATCGAGGCT
TCAACTGAGTTCCTTGACTCGGTATCAATCCGGTTTCAAATCGGCAACTTCTCGTTCCTTAAATCTCCGGTGCTGCTCAACAATGCCCTT
CAGGACCAATCTGAAAACCCTTCGTGTTCTCAGGATAGTCTTTTCTACAGCAGAGCATTTTGGGTTACCAAATCAATAATTGCTTGGAAT
GTGTGTGCTGGAGAAGGTGAATGTTACTTATATGCTAGTAGAAAGGCTGGATTATGTGTTACTGATGATGGAATTCAAGGCCATGATGTG
AAAATCAAACTAGAACGGACAAATTATGGACTTCCAXCAGCAGCATTTGAAGTCCCTGCAACTCTGGACTTCCAAAGTTTAATCAAGTGC
CAATTAGCTGTTGGCATCTTCAATTCTTATGGAAAATGTGCAAGTGCTACTGGATTGCAGTTACCTGGTATTCTCGATGAGTTATTCTCC
TATACTGGGCCCCTTGGTGCTGTTTTTGCCACTGAAGCTGTCTCTCTCTACCTTTGGGCACCAACTGCTCAAGCAGTGCAAGCTCTCATT
TATAAGAGTCCGTCAGAGGCTGACCCAGTAGAAATAGTTCAGCTCAAGGAGTTAGACGGTGTTTGGAGTGCTAAGGGCCAAAGCATTGGG
AGGGTTGCTACX\
Edits in Original Sequence 
GTAACTGTAATTTAA(5')ATGTCTGCTTTACTTTCATCCACTCCATTTTCCGCCATTTTCGCACCTTCCGAGCTCACTCGXCTTCCTTC
TTCCAGCTCAATCGAGGCTTCAACTGAGTTCCTTGACTCGGTATCAATCCGGTTTCAAATCGGCAACTTCTCGTTCCTTAAATCTCCGGT
GCTGCTCAACAATGCCgCTTCAGGACCAATCTGAAAACCCTTCGTGTTCTCAGGATAGTCTTTTCTACAGCAGAGCATTTTGGGTTACCA
AATCAATAATTGCTTGGAATGTGTGTGCTGGAGAAGGTGAATGTTACTTATATGCTAGTAGAAAGGCTGGATTATGTGTTACTGATGATG
GAATTCAAGGCCATGATGTGAAAATCAAACTAGAACGGACAAATTATGGACTTCCAXCAGCAGCATTTGAAGTCCCTGCAACTCTGGACT
TCCAAAGTTTAATCAAGTGCCAATTAGCTGTTGGCATCTTCAATTCTTATGGAAAATGTGCAAGTGCTACTGGATTGCAGTTACCTGGTA
TTCTCGATGAGTTATTCTCCTATACTGGGCCCCTTGGTGCTGTTTTTGCCACTGAAGCTGTCTCTCTCTACCTTTGGGCACCAACTGCTC
AAGCAGTGCAAGCTCTCATTTATAAGAGTCCGTCAGAGGCTGACCCAGTAGAAATAGTTCAGCTCAAGGAGTTAGACGGTGTTTGGAGTG
CTAAGGGCCAAAGCATTGGGAGGGTTGCTACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan