ESTScan Details for Unigene SGN-U289318

Score 
286
Direction 
Forward
Predicted Peptide Sequence 
HXEVVMASSKIFLIFILAALIATPVAVAQLGGLLGGLLGPISIDGVLFCSLNGKIDVLNGATTPIFPNASVQLRCGAGNVVSSTTTNGSG
AFSLVLNPVQNILSSLLSNCNIVVTTPLSTCNASLPSVGVLQAPLQIVGRTTGGLVNLVTGVFQLIPLLN
Predicted Coding Sequence 
XCACATXAAGAAGTTGTCATGGCCTCATCAAAAATTTTCTTGATTTTCATTTTGGCTGCATTAATAGCAACCCCTGTTGCAGTAGCCCAA
TTAGGAGGACTTCTGGGTGGCCTTCTTGGCCCAATAAGTATAGATGGGGTTCTATTTTGTAGCCTTAACGGCAAAATAGATGTCCTCAAT
GGAGCCACCACCCCAATTTTCCCTAATGCATCGGTGCAATTGCGGTGTGGAGCAGGAAATGTAGTATCAAGTACAACAACAAATGGATCA
GGAGCGTTTTCGTTGGTGTTGAATCCAGTACAAAATATATTATCATCATTGTTGTCTAACTGCAACATAGTGGTTACAACTCCGCTCTCA
ACATGTAACGCTAGCTTACCATCCGTTGGGGTTCTGCAGGCACCTTTGCAGATTGTTGGGAGAACCACTGGTGGACTTGTCAATTTAGTT
ACTGGTGTTTTTCAACTTATTCCCCTACTCAATTAA\
Edits in Original Sequence 
(5')XCACATXAAGAAGTTGTCATGGCCTCATCAAAAATTTTCTTGATTTTCATTTTGGCTGCATTAATAGCAACCCCTGTTGCAGTAGC
CCAATTAGGAGGACTTCTGGGTGGCCTTCTTGGCCCAATAAGTATAGATGGGGTTCTATTTTGTAGCCTTAACGGCAAAATAGATGTCCT
CAATGGAGCCACCACCCCAATTTTCCCTAATGCATCGGTGCAATTGCGGTGTGGAGCAGGAAATGTAGTATCAAGTACAACAACAAATGG
ATCAGGAGCGTTTTCGTTGGTGTTGAATCCAGTACAAAATATATTATCATCATTGTTGTCTAACTGCAACATAGTGGTTACAACTCCGCT
CTCAACATGTAACGCTAGCTTACCATCCGTTGGGGTTCTGCAGGCACCTTTGCAGATTGTTGGGAGAACCACTGGTGGACTTGTCAATTT
AGTTACTGGTGTTTTTCAACTTATTCCCCTACTCAATTAA\(3')GTAATTAATTACTTACCCAAAAATGCTACCTACTCCTTTATGTGT
TGTTTAATTAATTAATGTTGCCTAGTGATGCATCAGCTAGTTAATGTTCCAGCTGATTGCATAAATAAGGATTAATGTTGTTTGTGTCCA
CTGTAATTGTTTGAATGTTGGAGTGTTTGTCATTATACAATTGTGCAAATAATATTTGCAGTTAAGTGTAATATCATCATATACATTCAA
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan