ESTScan Details for Unigene SGN-U289436

Score 
158
Direction 
Forward
Predicted Peptide Sequence 
FENAGEQRLANGFLAFEGXKNPKAYKFVAKMMALSELTDDIVGSMAVGATFSDFGGQINSLDFHRTEDLLITASEDDSIRLFDIANGKLL
KTTYHKKHGADEYALPTTLILLYALQYXNLDVHGESLRYLSMYDNRCLRYFKGHKERVVSLCMSPVNDSFLSGSLDHSVRIWDLRVNAX
Predicted Coding Sequence 
XXCTTTGAGAATGCCGGTGAGCAGCGTTTAGCAAATGGTTTTTTAGCTTTTGAGGGTAXTAAAAACCCTAAAGCATACAAGTTTGTTGCA
AAGATGATGGCACTGTCGGAGCTCACCGATGACATTGTTGGGAGCATGGCCGTTGGAGCCACTTTCTCAGATTTTGGTGGGCAGATAAAC
TCACTTGATTTTCATCGGACAGAAGATTTACTGATAACCGCTAGTGAGGATGACTCAATTCGACTTTTTGACATTGCCAATGGGAAGTTG
CTGAAGACTACATATCATAAGAAGCATGGAGCTGATGAATATGCTTTACCCACCACCCTCATTCTGTTATATGCTCTTCAATACAXCAAC
TTGGATGTGCATGGAGAGTCTTTGCGGTACCTATCCATGTACGATAATCGATGTCTTCGTTACTTTAAGGGACATAAAGAGAGGGTTGTA
TCACTGTGCATGTCTCCGGTTAATGACAGCTTTTTGTCTGGATCTCTTGACCATAGTGTGAGAATATGGGATCTTCGCGTAAATGCATGX
\
Edits in Original Sequence 
(5')XXCTTTGAGAATGCCGGTGAGCAGCGTTTAGCAAATGGTTTTTTAGCTTTTGAGGGTAXTAAAAACCCTAtAAGCATACAAGTTTG
TTGCAAAGATGATGGCACTGTCGGAGCTCACCGATGACATTGTTGGGAGCATGGCCGTTGGAGCCACTTTCTCAGATTTTGGTGGGCAGA
TAAACTCACTTGATTTTCATCGGACAGAAGATTTACTGATAACCGCTAGTGAGGATGACTCAATTCGACTTTTTGACATTGCCAATGGGA
AGTTGCTGAAGACTACATATCATAAGAAGCATGGAGCTGATcGAATATGCTTTACCCACCACCCTCATTCTGTTATATGCTCTTCAATAC
AXCAACTTGGATGTGCATGGAGAGTCTTTGCGGTACCTATCCATGTACGATAATCGATGTCTTCGTTACTTTAAGGGACATAAAGAGAGG
GTTGTATCACTGTGCATGTCTCCGGTTAATGACAGCTTTTTGTCTGGATCTCTTGACCATAGTGTGAGAATATGGGATCTTCGCGTAAAT
GCATGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan