ESTScan Details for Unigene SGN-U289652

Score 
308
Direction 
Forward
Predicted Peptide Sequence 
QVCLGGLKNLRAEREAVVSILNNCLXGKFEEQQVLTAPVIDAPGHQGTLSRNNDHWYPPQADCAVLIIDSTTGGFEAGISKDGQTREHAL
LAFTLGVKQMIAAATRWMLPPQVLQARYDEIVKEVSSYLKKVGYNPDKIPFVPISX
Predicted Coding Sequence 
XXTCAAGTATGCCTGGGTGGCTTGAAAAACTTAAGGGCTGAACGTGAAGCCGTGGTATCAATATTGAATAATTGCCTTGXTGGAAAGTTT
GAAGAACAACAAGTACTTACTGCACCTGTGATTGATGCCCCCGGACACCAGGGAACTTTATCAAGAAACAATGATCACTGGTACCCTCCX
CAGGCCGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGAAGCTGGTATCTCTAAAGATGGTCAGACCCGTGAACATGCA
TTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGATTGCTGCTGCAACAAGATGGATGCTACCACCCCAAGTACTCCAAGCTAGGTACGAT
GAAATTGTAAAGGAAGTTTCTTCGTACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCATTTGTCCCCATCTCTGXX\
Edits in Original Sequence 
(5')XXTCAAGTATGCCTGGGTGGCTTGAAAAACTTAAGGGCTGAACGTGAAGCCGTGGTATCAATATTGAATAATTGCCTTGXTGGAAA
GTTTGAAGAACAACtAAGTACTTACTGCACCTGTGATTGATGCCCCCGGACACCAGGGAACTTTATCAAGAAACAATGATCACTGGTACC
CTCCXCAGGCCGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGAAGCTGGTATCTCTAAAGATGGTCAGACCCGTGAAC
ATGCATTGCTTGCTTTCACCCTTGGTGTCAAGCAAATGAtTTGCTGCTGCAACAAGATGGATGCTACCAcCCCCAAGTACTCCAAGCTAG
GTACGATGAAATTGTAAAGGAAGTTTCTTCGTACCTCAAGAAGGTTGGTTACAACCCTGACAAAATCCCATTTGTCCCCATCTCTGXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan