ESTScan Details for Unigene SGN-U289657

Score 
151
Direction 
Forward
Predicted Peptide Sequence 
ETXIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTXEHALLLHLGVSNDLCCTKMDVTTPKYSKAX
Predicted Coding Sequence 
GAGACTTTXATCAAGAACATGATCACTGGTACTTCCCAGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGAAGCT
GGTATCTCTAAAGATGGTCAGACCGXTGAACATGCATTGTTGCTTCACCTTGGTGTCAGCAATGATCTGTGTTGTACCAAGATGGATGTT
ACCACCCCCAAGTACTCCAAGGCTAXX\
Edits in Original Sequence 
(5')GAGACTTTXATCAAGAACATGATCACTGGTACTTCCCAGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGA
AGCTGGTATCTCTAAAGATGGTCAGACCGXTGAACATGCATTGTTGCTTCACCTTGGTGTCAGCAATGATCTGTGTTGTACCAAGATGGA
TGTTACCACCCCCAAGTACTCCAAGGCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan