ESTScan Details for Unigene SGN-U289658

Score 
575
Direction 
Forward
Predicted Peptide Sequence 
MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIEKVEKEAAEMNKKSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVI
DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMIAAVTRFAFIDGGINCYSKXDXVMLILXVVSY
XMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPIXRFEGDNMIERSTNLDWYKGPTLLDA
Predicted Coding Sequence 
ATGGGTAAGGAAAAGATTCACATCAGTATTGTGGTAATTGGCCACGTCGACTCTGGAAAGTCGACTACCACAGGTCACTTGATCTACAAG
CTTGGTGGTATTGACAAGCGTGTTATTGAGAAGGTTGAGAAGGAAGCTGCTGAGATGAACAAGAAGTCATTCAAGTATGCCTGGGTGCTT
GACAAACTTAAGGCCGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGTGGAAGTTTGAGACCACTAAGTACTACTGCACTGTGATT
GATGCCCCCGGACACAGGGACTTCATCAAGAACATGATCACTGGTACCTCCCAGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACT
GGTGGTTTTGAAGCTGGTATCTCTAAAGATGGTCAGACACGTGAACATGCATTGCTTGCTTTTACCCTTGGTGTCAAACAAATGATTGCT
GCTGTAACAAGGTTTGCTTTTATTGATGGTGGAATTAATTGTTATTCTAAGCANGATXATGTCATGCTAATTCTNNGTGTTGTTTCTTAT
AXGATGGATGCTACCACCCCCAAGTACTCCAAGGCTAGGTATGATGAAATCGTGAAGGAAGTTTCTTCCTATCTCAAGAAGGTCGGTTAC
AACCCTGACAAAATCCCATTTGTCCCCATCTNNCGTTTTGAAGGAGATAACATGATTGAGAGGTCTACCAACCTTGACTGGTACAAGGGC
CCAACCCTCCTTGATGCX\
Edits in Original Sequence 
GTTTTCCAATGATCTTTAGATTCTAAAGCATC(5')ATGGGTAAGGAAAAGATTCACATCAGTATTGTGGTAATTGGCCACGTCGACTCT
GGAAAGTCGACTACCACAGGTCACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTTATTGAGAAGGTTcGAGAAGGAAGCTGCTGA
GATGAACAAGAAgGTCATTCAAGTATGCCTGGGTGCTTGACAAACTTAAGGCCGAACGTGAGCGTGGTATCACCATTGATATTGCTTTGT
GGAAGTTTGAGACCACTAAGTACTACTGCACTGTGATTGATGCCCCCGGACACAGGGACTTCATCAAGAACATGATCACTGGTACCTCCC
AGGCTGACTGTGCTGTCCTCATTATTGACTCCACCACTGGTGGTTTTGAAGCTGGTATCTCTAAAGATGGTCAGACACGTGAACATGCAT
TGCTTGCTTTTACCCTTGGTGTCAAACAAATGAtTTGCTGCTGTAACAAGGTTTGCTTTTATTGATgGGTGGAATTAATTGTTATTCTAA
GCANGATXATGTCATGCTAATTCTNNGTGTTGTTTCTTATAXGATGGATGCTACCACCCCCAAGTACTCCAAGGCTAGGTATGATGAAAT
CGTGAAGGAAGTTTCTTCCTATCTCAAGAAGGTCGGTTACAACCCTGACAAAATCCCATTTGTCCCCATCTNNCGTTTTGAAGGAGATAA
CATGATTGAGAGGTCTACCAACCTTGACTGGTACAAGGGCCCAACCCTCCTTGATGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan