ESTScan Details for Unigene SGN-U289933

Score 
428
Direction 
Forward
Predicted Peptide Sequence 
STLGKLQPLMLAPEWNKFQVSAGTILCAGSRTFVHERVYDEFVEKAKVRALKRIVGDPFKKGVEQGPQIDTEQFEKILKYIKSGTXKGAT
LESGGEKLGSKGFYVQPTVFSNVQDNMLIARDEIFGPVQXPLEILVRLHFICNVAXACILFINTESDLETNRDVEEVIRRANSSHYGLAA
GVFTQNIDAANTISRALRVGTVWVYCFNIFDAAIPFGGYKVSGHGREKGVYSLSNYLQVKAIVTPLKINMAVVFPPAF
Predicted Coding Sequence 
TCCACTCTTGGAAAATTGCAACCTCTGATGCTTGCTCCGGAATGGAATAAATTTCAAGTATCTGCAGGGACAATCCTCTGTGCTGGATCT
CGGACATTCGTACATGAAAGAGTATATGATGAATTTGTGGAGAAAGCCAAGGTTCGTGCGTTAAAACGTATCGTTGGAGACCCTTTCAAG
AAGGGAGTTGAACAAGGTCCTCAGATTGATACAGAGCAATTTGAGAAGATCCTTAAGTACATAAAATCTGGTACTGAXAAGGGGGCTACT
CTTGAGTCTGGAGGGGAAAAATTGGGTTCCAAGGGATTCTATGTCCAACCTACTGTCTTCTCAAATGTCCAGGATAACATGCTGATTGCC
AGAGATGAGATATTTGGACCAGTGCAGXTCCCTCTTGAAATTCTAGTGAGATTACATTTCATTTGTAATGTAGCTGXTGCTTGTATTTTG
TTTATTAACACTGAATCTGACCTCGAAACAAACAGGGATGTTGAAGAGGTCATTCGAAGGGCAAACTCGTCACATTATGGGTTGGCGGCG
GGTGTTTTTACCCAGAATATAGATGCAGCCAACACAATATCTCGAGCCCTTAGAGTAGGGACAGTGTGGGTTTACTGCTTTAATATCTTT
GATGCTGCCATTCCTTTTGGTGGTTATAAGGTGAGTGGACATGGAAGAGAAAAGGGAGTCTACAGCCTAAGTAACTACTTGCAAGTCAAA
GCTATTGTTACTCCTCTGAAGATCAACATGGCTGTAGTTTTCCCTCCTGCTTTC\
Edits in Original Sequence 
(5')TCCACTCTTGGAAAATTGCAACCTCTGATGCTTGCTCCGGAATGGAATAAATTTCAAGTATCTGCAGGGACAATCCTgCTGTGCTG
GATCTCGGACATTCGTACATGAAAGAGTATATGATGAATTTGTGGAGAAAGCCAAGGTTCGTGCGTTAAAACGTATCGTTGGAGACCCTT
TCAAGAAGGGAGTTGAACAAGGTCCTCAGATTGATACAGAGCAATTTGAGAAGATCCTTAAGTACATAAAATCTGGTACTGAXAAGGGGG
CTACTCTTGAGTCTGGAGGGGAAAAATTGGGTTCCAAGGGATTCTATGTCCAACCTACTGTCTTCTCAAATGTCCAGGATAACATGCTGA
TTGCCAGAGATGAGATATTTGGACCAGTGCAGXTCCCTCTTGAAATTCTAGTGAGATTACATTTCATTTGTAATGTAGCTGXTGCTTGTA
TTTTGTTTATTAACACTGAATCTGACCTCGAAACAAACAGGGATGTTGAAGAGGTCATTCGAAGGGCAAACTCGTCACATTATGGGTTGG
CGGCGGGTGTTTTTACCCAGAATATAGATGCAGCCAACACAATATCTCGAGCCCTTAGAGTAGGGACAGTGTGGGTTTACTGCTTTAATA
TCTTTGATGCTGCCATTCCTTTTGGTGGTTATAAGGTGAGTGGACATGGAAGAGAAAAGGGAGTCTACAGCCTAAGTAACTACTTGCAAG
TCAAAGCTATTGTTACTCCTCTGAAGATcCAACATGGCTGTAGTTTTCCCTCCTGCTTTC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan