ESTScan Details for Unigene SGN-U289936

Score 
159
Direction 
Forward
Predicted Peptide Sequence 
KFHRVKGIKIITSTTLLLAVAAAAGFFYCSAISFPCPTISLPNLPLPAASTTPPPPEXPYPLLTPPPPPNYPPPSNSNHHFNSSQSSYDT
RSESIKINILLIIILTAIIDEVGISLAATPPPWSAVPYVDYQNAKKIKNDVNVDKDTSGFMFDEFNKDFH
Predicted Coding Sequence 
XGGAAATTTCATAGAGTAAAAGGCATCAAAATCATCACCTCCACCACTCTCCTCCTTGCTGTTGCTGCGGCCGCCGGCTTCTTCTATTGC
TCCGCCATTTCCTTCCCTTGCCCTACCATCTCCCTACCCAATCTACCCCTACCTGCAGCTTCTACAACACCTCCCCCTCCTGAAAXTCCT
TATCCTTTACTAACTCCTCCTCCCCCACCCAACTACCCACCTCCTTCCAATTCGAATCACCATTTTAATTCCAGTCAGTCTAGTTATGAT
ACTAGATCTGAATCTATTAAAATCAATATCCTCCTTATTATCATCCTCACAGCAATAATAGATGAGGTGGGTATTAGCCTCGCCGCCACT
CCACCGCCGTGGTCGGCGGTGCCGTATGTGGATTACCAAAATGCGAAGAAGATTAAAAATGATGTTAATGTTGATAAGGATACTTCAGGG
TTCATGTTTGATGAATTCAACAAGGATTTTCAT\
Edits in Original Sequence 
(5')XGGAAATTTCATAGAGTAAAAGGCATCAAAATCATCACCTCCACCACTCTCCTCCTTcGCTGTTGCTGCGGCCGCCGGCTTCTTCT
ATTGCTCCGCCATTTCCTTCCCTTGCCCTACCATCTCCCTACCCAATCTACCCCTACCTGCAGCTTCTACAACACCTCCCCCtTCCTGAA
AXTCCTTATCCTTTACTAACTCCTCCTCCCCCACCCAACTACCCACCTCCTTCCAATTCGAATCACCATTTTAATTCCAGTCAGTCTAGT
TATGATACTAGATCTGtAATCTATTAAAATCAATATCCTCCTTATTATCATCCTCACAGCAATAATAGATGAGGTGGGTATTAGCCTCtG
CCGCCACTCCACCGCCGTGGTCGGCGGTGCCGTATGTGGATTACCAAAATGCGAAGAAGATTAAAAATGATGTTAATGTTGATAAGGATA
CTaTCAGGGTTCATGTTTGATGAATTCAACAAGGATTTTCAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan