ESTScan Details for Unigene SGN-U290245

Score 
122
Direction 
Forward
Predicted Peptide Sequence 
MPLRLEIKRKLAXKIRKGKGRGSTSYGAMDIDKFIFRXPFAFGTTNPDNGTIFEVTELPVRSAKFIARKQWIVAGSDDMFIRVYNYNTMD
KVKVFEGTPDYIRCVAVHPTLPYVLSSSDX
Predicted Coding Sequence 
ATGCCTCTAAGATTGGAGATTAAGAGGAAACTTGCTXCAAAGATCAGAAAGGGTAAAGGCCGTGGATCTACATCCTACGGAGCCATGGAT
ATTGACAAGTTTATATTCAGGGNACCATTTGCATTTGGAACTACCAACCCAGACAATGGCACAATCTTTGAAGTTACTGAATTACCAGTA
AGATCAGCGAAATTTATAGCACGCAAACAGTGGATTGTTGCTGGTTCCGATGACATGTTTATTCGTGTATACAATTATAATACCATGGAT
AAGGTCAAAGTATTCGAGGGCACACCAGATTATATTAGGTGTGTGGCTGTTCATCCTACACTACCATATGTGCTGTCATCATCTGATGXX
\
Edits in Original Sequence 
GTATGATCTCCTCTACCGTTCGTCCCATTTTCTTTCTTCTTATTATTACAGAGGTTGCTCGCTGCCATTAGCAAAACCTCTACTCATTTT
CTCTCTTTTTCGATCTCTCTCCGGCACTTTGCCACTTAGCGAGCAATTCGAATTGGAAGATTTCTGCAGCTGAGTAGCTGGTGGATCTTT
AGGATTCTTCACACTCAAATCTCTGATTTATTGCCTTTTTCCAATAGAATTCGCATTCGTCGGTGAAA
(5')ATGCCTCTAAGATTGGAG
ATTAAGAGGAAACTTGCTXCAAAGATCAGAAAGGGTAAAGGCCGTGGATCTACATCCTACGGAGCCATGGATATTGACAAGTTTATATTC
AGGGNACCATTTGCATTTGGAACTACCAgACCCAGACAATGGCACAATCTTTcGAAGTTACTGAATTACCAGTAAGATCAGCGAAATTTA
TAGCACGCAAACAGTGGATTGTTGCTGGTTCCGATGACATGTTTATTCGTGTATACAATTATAATACCATGGATAAGGTCAAAGTATTCG
AGGGCACACaCAGATTATATTAGGTGTGTGGCTGTTCATCCTACACTACCATATGTGCTGTCATCATCTGATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan