ESTScan Details for Unigene SGN-U290268

Score 
440
Direction 
Reverse
Predicted Peptide Sequence 
KGQALICHYYPACPQPELTLGIDKHTDISFFTILLQDQSGGFQIMHNNQWVDVEPIEQGLVVNIGDFLQILSNDKFVSINHRAVAKKVGP
RISAACFFTGVFEPSKIYGPIKELISEENPPLYKEFIASDYITKFFSKPLDISGXGSFPTLKNDLAPYRQAAAKITHKLLEKISAFYLL
Predicted Coding Sequence 
XXCAAAGGACAAGCATTGATATGCCACTACTACCCAGCCTGCCCACAGCCAGAGCTAACTCTTGGTATCGATAAGCATACAGATATTTCT
TTCTTCACAATCTTGCTTCAAGATCAAAGTGGTGGATTTCAAATCATGCATAATAACCAATGGGTCGATGTTGAACCGATTGAACAAGGT
TTGGTTGTTAACATTGGTGACTTTCTTCAGATCCTTTCAAATGACAAATTTGTAAGCATAAATCATAGAGCTGTAGCGAAAAAGGTAGGA
CCAAGGATATCAGCAGCATGCTTCTTCACTGGGGTTTTCGAACCTTCAAAGATATATGGTCCAATCAAAGAGCTCATATCAGAAGAAAAT
CCTCCACTATATAAAGAATTTATTGCTAGTGATTACATCACTAAGTTTTTCTCCAAGCCTCTTGATATTTCCGGTXCTGGATCATTTCCG
ACTCTGAAGAATGACCTGGCGCCATATCGCCAAGCAGCAGCAAAAATCACACATAAACTTTTAGAAAAGATATCAGCATTTTATTTGCTG
TAA\
Edits in Original Sequence 
(5')XXCAAAGGACAAGCATTGATATGCCACTACTACCCAGCCTGCCCACAGCCAGAGCTAACTCTTGGTATCGATAAGCATACAGATAT
TTCTTTCTTCACAATCTTGCTTCAAGATCAAAGTGGTGGATTTCAAATCATGCATAATAACCAATGGGTCGATGTTGAACCGATTGAACA
AGGTTTGGTTGTTAACATTGGTGACTTTCTTCAGATCCTTTCAAATGACAAATTTGTAAGCATAAATCATAGAGCTGTAGCGAAAAAGGT
AGGACCAAGGATATCAGCAGCATGCTTCTTCACTGGGGTTTTCGAACCTTCAAAGATATATGGTCCAATCAAAGAGCTCATATCAGAAGA
AAATCCTCCACTATATAAAGAATTTATTGCTAGTGATTACATCACTAAGTTTTTCTCCAAGCCTCTTGATATTTCCGGTXCTGGATCATT
TCCGACTCTGAAGAATGACCTGGCGCCATATCGCCAAGCAGCAGCAAAAATCACACATAAACTTTTAGAAAAGATATCAGCATTTTATTT
GCTGTAA\(3')ATAATGTGATTTGATTTGCTGTAAAATAAGGCTCATATTCATGATGAAGGGATAAATCTTAAGAACACTTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan