ESTScan Details for Unigene SGN-U290347

Score 
144
Direction 
Reverse
Predicted Peptide Sequence 
MISFSNLLHNVSSYRXEIKVDRPGHGPCHRATQDTSFEHDYVNTLRXESIFKLNYYPPCPDIQEFNAKKLIGFGENTDPQIISILRSNTT
SDLQILLKNDHRISVPPDHX
Predicted Coding Sequence 
ATGATATCTTTCTCAAACCTCCTTCACAATGTGAGCTCATATCGTGAXGAGATAAAGGTTGATAGGCCAGGACATGGGCCTTGTCACAGG
GCAACACAAGACACTTCATTTGAACATGATTATGTTAACACTTTAAGAGXTGAATCTATTTTCAAGCTCAATTACTATCCTCCATGTCCT
GATATTCAAGAATTCAATGCCAAAAAATTGATTGGATTTGGAGAAAATACCGATCCACAAATCATATCGATATTAAGATCCAACACCACA
TCCGACCTTCAAATTTTACTCAAAAATGACCACAGAATTTCTGTACCACCTGATCATTTX\
Edits in Original Sequence 
ACAATAAAGTGTGGACTTTAAAGCTGGTTGTCCAATCTTTCCTTTCTAAGGCTTCCCATCATATTGAATACTTTGGTTCAAGAAGACTCT
AAAAGAAGGAATTTATGGCTATATAGAGTAAGTTAATAATATTCTTTGATCAGACTAACTAAAGCACTTAGTACCTCATTTTAAGATAAA
GGACCATGAGATCAACATAAAGAGTTTCCTACTAAAAACGCAACAAATCAAGAAAAGAGGAAGGGTAAATAAACACTTTGTTCTTCCTCA
AAATTGTCACGTATAGTCTCTAATAAGATAGATCAATAGTAGAAAAGATTATTAATCTCAACAATTTCTATTGAAGTTACTAACGTTTCA
AATCTCATTAAGTTTCTGAGTAATCCATATGCTTTCAAGGCTTAAATACATATTGACATTATGTTTGTGTAGAAATCAATATGAATGTGG
AAAAGAGTTTAGAACTAATTGAATGATTTTGATGGCCTGATGAGTGAATTGAGAAGAACTAAAAC
(5')ATGATATCTTTCTCAAACCTC
CTTCACAATGTGAGCTCATATCGTGAXGAGATAAAGGTTGATAGGCCAGGACATGGGCCTTGTCACAGGGCAACACAAGACACTTCATTT
GAACATGATTATGTTAACACTTTAAGAGXTGAATCTATTTTCAAGCTCAATTACTATCCTCCATGTCCTGATATTCAAGAATTCAATGCC
AAAAAATTGATTGGATTTGGAGAAAATACCGATCCACAAATCATATCGATATTAAGATCCAACACCACATCCGACCTTCAAATTTTACTC
AAAAATGACCACAGAATTTCTGTACCACCTGATCATTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan