ESTScan Details for Unigene SGN-U290452

Score 
527
Direction 
Forward
Predicted Peptide Sequence 
AYFQLMEKYLIEPKIEHYGCMVNLLGRAGQLEKAYEFVKSMKIDSDPILWGTLLTACRIHGDVRLAEKIMEFLVEQDLATSGTYVLLSNI
YAAAGDWDGVAKVRALMKRSGVDKEPGCSSIEVNNKVHEFLAGDMKHPKSKEIYIMLEEMNKWLEAHGYSPQIEIVLHNLGEVEKQQPLA
VHSAKAXPIAYGLIRYSGRNYNSKIXQESTVFVQIANAVTKLISKHHRTAKIIVXGTGIGFHHFVDGHVL
Predicted Coding Sequence 
XXTGCTTATTTTCAGTTAATGGAGAAGTATTTAATTGAGCCAAAGATTGAGCACTATGGTTGCATGGTGAATCTTCTTGGACGAGCTGGA
CAGCTAGAAAAAGCTTATGAATTTGTCAAAAGTATGAAGATTGATTCCGATCCTATTTTATGGGGAACTCTACTGACTGCTTGTAGGATT
CATGGGGACGTAAGGCTTGCAGAGAAAATTATGGAGTTCCTAGTCGAACAGGATCTTGCTACTTCAGGTACTTATGTTCTGCTATCCAAC
ATATATGCTGCTGCTGGTGATTGGGATGGGGTGGCAAAGGTGAGGGCATTGATGAAAAGAAGCGGGGTTGACAAGGAACCTGGCTGTAGC
TCCATTGAGGTAAACAATAAAGTGCACGAGTTCCTTGCGGGTGATATGAAGCATCCCAAAAGCAAAGAAATTTACATAATGCTGGAGGAG
ATGAACAAGTGGCTCGAGGCTCATGGGTACTCACCGCAGATTGAAATAGTCTTGCATAATCTTGGGGAAGTTGAGAAGCAGCAGCCACTT
GCGGTTCATAGTGCAAAGGCTAXGCCCATTGCTTATGGACTAATTAGGTACTCAGGCAGGAACTACAATTCAAAGATTGXTCAAGAATCT
ACGGTGTTTGTCCAGATTGCCAATGCTGTCACAAAGCTCATTTCAAAACATCACAGGACNGCAAAAATCATTGTTAAXGGGACCGGAATC
GGTTTCCATCATTTCGTAGATGGTCATGTCTTG\
Edits in Original Sequence 
(5')XXTGCTTATTTTCAGTTAATGGAGAAGTATTTAATTGAGCCAAAGATTGAGCACTATGGTTGCATGGTGAATCTTCTTGGACGAGC
TGGACAGCTAGAAAAAGCTTATGAATTTGTCAAAAGTATGAAGATTGATTCCGATCCTATTTTATGGGGAACTCTACTGACTGCTTGTAG
GATTCATGGGGACGTAAGGCTTGCAGAGAAAATTATGGAGTTCCTAGTCGAACAGGATCTTGCTACTTCAGGTACTTATGTTCTGCTATC
CAACATATATGCTGCTGCTGGTGATTGGGATGGGGTGGCAAAGGTGAGGGCATTGATGAAAAGAAGCGGGGTTGACAAGGAACCTGGCTG
TAGCTCCATTGAGGTAAACAATAAAGTGCACGAGTTCCTTGCGGGTGATATGAAGCATCCCAAAAGCAAAGAAATTTACATAATGCTGGA
GGAGATGAACAAGTGGCTCGAGGCTCATGGGTACTCACCGCAGATTGAAATAGTCTTGCATAATCTTGGGGAAGTTGAGAAGCAGCaAGC
CACTTGCGGTTCATAGTGCAAAGGCTAXGCCCATTGCTTATGGACTAATTAGGTACTCAGGCAGGAACTACAATTCAAAGATTGXTCAAG
AATCTACGGTGTTTGTCCAGATTGCCAATGCTGTCACAAAGCTCATTTCAAAACATCACAGGACNGCAAAAATCATTGTTAAXGGGACCG
GAATCGGTTTCCATCATTTCGTAGATGGTCATGTCTTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan