ESTScan Details for Unigene SGN-U290475

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
PLIDLQNINLNNKEIVKQIQEASETWGFFQXDHHGIPGPRPKRNVCGGSLRFFTKAKISRFKKPYLISRDVGGKLCTIANFDLFSEKSLA
ANWRDSLYSVMAPNPANPEEIPETCREITIEYSNYVMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEVAIGTSRHA
DNDFFTVLLQDDIGGLQVFHKNQWVDVPPTHGALVVNIGDILQLISNDKYQERSAQSIGNIKIGXKKYSKQVSSAQGHFATFLEFMDQFE
EVII
Predicted Coding Sequence 
XXCCCATTAATAGACCTCCAAAACATCAACCTGAACAATAAAGAAATAGTGAAACAAATTCAAGAAGCATCAGAGACATGGGGTTTCTTC
CAAGXTGATCATCATGGTATTCCCGGTCCCCGTCCTAAACGAAATGTTTGCGGTGGATCACTTAGGTTTTTCACGAAGGCCAAAATTTCG
AGGTTTAAAAAGCCATACCTAATAAGTCGAGATGTTGGAGGAAAGTTATGTACAATTGCCAATTTTGATTTGTTTAGTGAGAAATCTCTT
GCAGCAAATTGGAGAGACTCACTTTACTCTGTTATGGCTCCTAATCCTGCTAATCCCGAGGAAATCCCCGAGACATGCAGGGAAATTACA
ATTGAGTACTCAAATTATGTGATGAATTTGGGCTACACATTGCTTGAATTATTTTCAGAAGGACTTGGTTTAAAACCAAACCATCTCAAA
GAAATGGGATGTGCTGAGGGACTAGGCATTTTGTGCAATTACTATCCTAAATGTCCACAACCAGAAGTTGCAATTGGCACAAGTAGACAT
GCTGATAATGATTTTTTCACAGTGCTTTTGCAAGATGATATTGGTGGACTTCAAGTTTTTCACAAGAATCAATGGGTTGATGTTCCTCCT
ACTCATGGAGCTTTAGTTGTCAATATTGGTGACATTCTTCAGCTTATATCGAATGACAAATACCAAGAGCGTAGTGCACAGAGTATTGGC
AACATAAAAATTGGTXCCAAGAAATATTCAAAGCAAGTTTCTTCAGCACAGGGCCATTTTGCCACTTTCTTAGAATTTATGGACCAATTT
GAGGAAGTTATTATCTAA\
Edits in Original Sequence 
(5')XXCCCATTAATAGACCTCCAAAACATCAACCTGAACAATAAAGAAATAGTGAAACAAATTCAAGAAGCATCAGAGACATGGGGTTT
CTTCCAAGXTGATCATCATGGTATTCCCGGTCCCCGTCCTAAACGAAATGTTTGCGGTGGATCACTTAGGTTTTTCACGAAGGCCAAAAT
TTCGAGGTTTAAAAAGCCATACCTAATAAGTCGAGATGTTGcGAGGAAAGTTATGTACAATTGCCAATTTTGATTTGTTTAGTGAGAAAT
CTCTTGCAGCAAATTGGAGAGACTCACTTTACTCTGTTATGGCTCCTAATCCTGCTAATCCCGAGGAAATCCCCGAGACATGCAGGGAAA
TTACAATTGAGTACTCAAATTATGTGATGAATTTGGGCTACACATTGCTTGAATTATTTTCAGAAGGACTTGGTTTAAAACCAAACCATC
TCAAAGAAATGGGATGTGCTGAGGGACTAGGCATTTTGTGCAATTACTATCCTAAATGTCCACAACCAGAAGTTGCAATTGGCACAAGTA
GACATGCTGATAATGATTTTTTCACAGTGCTTTTGCAAGATGATATTGGTGGACTTCAAGTTTTTCACAAGAATCAATGGGTTGATGTTC
CTCCTACTCATGGAGCTTTAGTTGTCAATATTGGTGACATTCTTCAGCTTATATCGAATGACAAATACCAAGAGCGTAGTGCACAGAGTA
TTGGCAACATAAAAATTGGTXCCAAGAAATATTCAAtAGCAAGTTTCTTCAGCACAGGGCCATTTTGCCACTTTCTTAGAATTTATGGAC
CAATTTGAGGAAGTTATTATCTAA\(3')AATGATTCCTTCCAAAAGTATAGAGCAACCACACAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan