ESTScan Details for Unigene SGN-U290477

Score 
185
Direction 
Forward
Predicted Peptide Sequence 
QQGTNKHKMTKAXLETLSLQTVELKVGMCCSGCERVIKDAVYKLRGVESVSVELEMEKVTVVGYVDRNRVLKAVRRHGKRAEFWPYPNPP
LYFTSSNNYFKDMNSEYRDSYNYWRHGYNVADKHGNLHVTHRGDDKVSNLFNDDNVNACCIM
Predicted Coding Sequence 
XATCAACAAGGCACAAACAAACACAAAATGACTAAGGCTXTACTAGAAACACTTTCTTTACAGACTGTGGAACTCAAAGTAGGGATGTGT
TGTAGTGGATGTGAGAGAGTTATTAAAGATGCTGTCTACAAGCTTAGAGGAGTAGAATCGGTATCGGTAGAACTAGAGATGGAGAAAGTA
ACGGTGGTGGGATATGTGGATCGAAATAGGGTGCTAAAAGCAGTGCGGAGGCATGGGAAGCGGGCGGAATTTTGGCCATACCCAAATCCC
CCACTATATTTCACATCATCAAATAACTACTTCAAAGACATGAATAGTGAATATAGAGATAGTTACAATTACTGGCGCCATGGTTATAAT
GTTGCGGACAAACATGGCAATCTTCATGTTACTCATCGAGGTGATGACAAAGTTAGTAACCTCTTTAACGATGATAATGTCAATGCATGT
TGTATCATGTGA\
Edits in Original Sequence 
(5')XATCAACAAGGCACAAACAAACACAAAATGACTAAGGCTXTACTAGAAACACTTTCTTTACAGACTGTGGAACTCAAAGTAGGGAT
GTGTTGTAGTGGATGTGAGAGAGTTATTAAAGATGCTGTCTACAAGCTTAGAGGAGTAGAATCGGTATCGGTAGAACTAGAGATGGAGAA
AGTAACGGTGGTGGGATATGTGGATCGAAATAGGGTGCTAAAAGCAGTGCGGAGGCATGGGAAGCGGGCGGAATTTTGGCCATACCCAAA
TCCCCCACTATATTTCACATCATCAAATAACTACTTCAAAGACATGAATAGTGAATATAGAGATAGTTACAATTACTGGCGCCATGGTTA
TAATGTTGCGGACAAACATGGCAATCTTCATGTTACTCATCGAGGTGATGACAAAGTTAGTAACCTCTTTAACGATGATAATGTCAATGC
ATGTTGTATCATGTGA\(3')TCGATCGATCGATATAATATAATGAAGTATAGGATATGATGTGTATTGTGTAACGTAAGACAATATGTA
TGTATACCTACCTACTATGTATGTAATGCAACTAGTTGTTAATTAAGTTATTTTCTCAGTTTACATTTAGCAAAACCAGAATGCCAAACA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan