Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U290747

Score 
410
Direction 
Forward
Predicted Peptide Sequence 
MASSVMSSAAVATRGNGAQAQHGCTPSXGLKSAASFPVSRKQNLDITLHLLAMVEEVRCMQVWPPINMKKYETLSYLPDLSDEQLLKEVE
YLLKNGWVPCLEFETEVNIDXPLFLKFTSSTKFLYVVLWDIYVQHGFVYRENNKSPGYYDGQILDPCGSCPMFGCTDATQVLAEVEEAKK
AYPQAWXPIIGFDNVRQVQCISFIAYKPEDTKF
Predicted Coding Sequence 
ATGGCTTCTTCAGTGATGTCCTCAGCAGCTGTTGCCACCCGCGGCAATGGTGCACAAGCCCAGCATGGTTGCACCCCTTCAXCTGGCCTC
AAGTCCGCCGCCTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCCTCCATTTGCTAGCAATGGTGGAAGAAGTCAGATGCATG
CAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTCTCATACCTTCCTGATTTATCTGACGAGCAATTGCTCAAGGAAGTTGAG
TACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGGTTAACATTGATXCTCCTCTGTTTTTAAAATTTACTAGTAGT
ACTAAGTTTTTATATGTTGTGTTGTGGGATATATATGTGCAGCACGGATTTGTGTACCGTGAGAACAACAAGTCACCAGGATACTACGAT
GGXCAGATACTGGACCCATGTGGAAGTTGCCCCATGTTCGGGTGTACTGATGCAACCCAGGTCTTGGCTGAGGTGGAGGAGGCAAAGAAG
GCTTACCCACAGGCATGGNATCCTATCATCGGATTCGACAACGTTCGTCAAGTGCAGTGTATCAGTTTCATTGCTTACAAGCCCGAAGAT
ACTAAGTTCTAA\
Edits in Original Sequence 
CAAAGATAAGCACTCAGAA(5')ATGGCTTCTTCAGTGATGTCCTCAGCAGCTGTTGCCACCCGCGGCAATGGTGCACAAGCCCAGCATG
GTTGCACCCCTTCAXCTGGCCTCAAGTCCGCCGCCTCTTTCCCTGTTTCAAGGAAGCAAAACCTTGACATTACCCTCCATTTGCTAGCAA
TGGTGGAAGAAGTCAGATGCATGCAGGTGTGGCCACCAATTAACATGAAGAAGTACGAGACTCTCTCATACCTTCCTGATTTATCTGACG
AGCAATTGCTCAAGGAAGTTGAGTACCTATTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGGTTAACATTGATXCTCCTC
TGTTTTTAAAATTTACTAGtTAGTACTAAGTTTTTaATATGTTGTGTTGTGGGATATATATGTGCAGCACGGATTTGTGTACCGTGAGAA
CAACAAGTCACCAGGATACTACGATGGXCAGATACTGGACCCATGTGGAAGTTGCCCCATGTTCGGGTGTACTGATGCAACCCAGGTCTT
GGCTGAGGTGGAGGAGGCAAAGAAGGCTTACCCACAGGCATGGNATCCgTATCATCGGATTCGACAACGTTCGTCAAGTGCAGTGTATCA
GTTTCATTGCTTACAAGCCCGAAGATACTAAGTTCTAA\(3')AGATAACTAATTGCCCTATTTCTATGGGGACAGTTTGTTTGAATTCT
CCTTTGGTTTTTCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan