ESTScan Details for Unigene SGN-U290758

Score 
232
Direction 
Forward
Predicted Peptide Sequence 
MASSIVSSAAVATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRVXMHAGSNNNNYQYI
Predicted Coding Sequence 
ATGGCTTCCTCAATTGTCTCCTCAGCAGCCGTTGCTACCCGTAGCAATGTTGCTCAAGCTAGCATGGTCGCACCTTTCACCGGACTCAAA
TCCGCCGCGTCTTTCCCCGTTACTAAGAAGAACAACAACGTTGACATTACTTCCCTTGCTAGCAACGGTGGACGTGTTAXGATGCATGCA
GGTTCAAATAATAATAACTATCAGTATATATAA\
Edits in Original Sequence 
AAAAAAAAAAGCGTTTTATAGCTAAGTAGTAGCGTA(5')ATGGCTTCCTCAATTGTCTCCTCAGCAGCCGTTGCTACCCGTAGCAATGT
TGCTCAAGCTAGCATGGTCGCACCTTTCACCGGACTCAAATCCGCCGCGTCTTTCCCCGTTACTAAGAAGAACAACAACGTTGACATTAC
TTCCCTTGCTAGCAACGGTGGACGTGTTAXGATGCATGCAGGTTCAAATAATAATAACTATCAGTATATATAA\(3')TTTAAATTAACT
AGTTGTCGTTTATTTATAAATGTGGAATATATATATGTTAATGTAGGTGTGGCCACCAATTAACATGAAGAAATACGAGACATTGTCATA
CCTTCCTGACTTGTCCGATGAGCAATTGCTTAAGGAAGTTGAGTACCTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGA
GGTCAATATCTCCTACTTACTTTTACATGTGTACGTAATTTAATTAATTTGTTGAAGGAGAAAATAAATGTATGTTATATTATGTACAGC
ACGGATTTGTGTACCGTGAGCACCACAAGTCACCAGGATACTATGATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan