ESTScan Details for Unigene SGN-U290771

Score 
232
Direction 
Forward
Predicted Peptide Sequence 
VLRVETVNNSGKSGNYGAEFSSRDNNRXDGGQWGGFGAQSHGGNDHQHQRNANRRGNVGPHPRGDGTYHNGYGGRRDQERQNQDWKPHRG
WGNRDAHMXAQRGPARPFMGAPPHTSPPYIPGPMHVQPINSHGLPEVPPVFYFPGPFPDPLRMPMLSPVPPVFVHVPDTQLQIRIVNQMD
YYFTNENLIKDTFLRQNMDEHGWVPVTLX
Predicted Coding Sequence 
GTTTTGAGGGTGGAAACAGTCAATAATTCTGGAAAGTCAGGTAATTATGGTGCTGAATTTTCTTCAAGGGATAACAATCGTAAXGATGGT
GGACAATGGGGGGGATTTGGAGCTCAATCACATGGTGGAAATGACCACCAACATCAACGAAATGCAAATAGGAGAGGCAATGTTGGTCCA
CACCCCCGTGGAGATGGCACGTATCATAATGGTTATGGGGGTAGGCGTGATCAGGAACGGCAAAATCAGGATTGGAAACCCCACAGAGGT
TGGGGGAATAGGGATGCACACATGCANGCTCAAAGAGGTCCAGCTAGGCCATTCATGGGGGCCCCACCTCATACGTCTCCACCTTATATA
CCTGGGCCCATGCATGTGCAGCCTATCAACTCCCATGGTTTACCTGAAGTTCCACCTGTATTTTATTTTCCAGGTCCATTCCCTGATCCA
CTCAGAATGCCTATGCTTTCTCCTGTGCCACCTGTCTTCGTTCATGTACCTGATACCCAGTTGCAAATTAGAATAGTGAACCAGATGGAT
TATTATTTCACTAATGAGAATTTGATTAAGGACACATTCTTGCGACAGAACATGGATGAACATGGATGGGTTCCGGTTACACTAATX\
Edits in Original Sequence 
(5')GTTTTGAGGGTGGAAACAGTCAATAATTCTGGAAAGTCAGGTAATTATGGTGCTGAATTTTCTTCAAGGGATAACAATCGTAAXGA
TGGTGGACAATGGGGGGGATTTGGAGCTCAATCACATGGTGGAAATGACCACCAACATCAACGAAATGCAAATAGGAGAGGCAATGTTGG
TCCACACCCCCGTGGAGATGGCACGTATCATAATGGTTATGGGGGTAGGCGTGATCAGGAACGGCAAAATCAGGATTGGAAACCCCACAG
AGGTTGGGGGAATAGGGATGCACACATGCANGCTCAAAGAGGTCCAGCTAGGCCATTCATGGGGGCCCCACCTCATACGTCTCCACCTTA
TATACCTGGGCCCATGCATGTGCAGCCTATCAACTCCCATGGTTTACtCTGAAGTTCCACCTGTATTTTATTTTCCAGGTCCATTCCCTG
ATCCACTCAGAATGCCTATGCTTTCTCCTGTGCCACCTGTCTTCGTTCATGTACCTGATACCCAGTTGCAAATTAGAATAGTGAACCAGA
TGGATTATTATTTCACgTAATGAGAATTTGATTAAGGACACATTCTTGtCGACAGAACATGGATGAACATGGATGGGTTCCGGTTACACT
AATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan