ESTScan Details for Unigene SGN-U290775

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
AGQAAKLSPSASEISGNGRITMRKARRYSAPSSTPWDGPDRVKYLGPFYGESQATRLAEFPGDYGSDTAGLSPDPETFAKNHELEVIHX
Predicted Coding Sequence 
GCTGGACAGGCAGCGAAACTATCACCATCTGCCTCAGAAATTTCTGGAAATGGAAGGATCACTATGAGAAAGGCTCGGCGCTATTCCGCC
CCATCTAGCACCCCATGGGATGGCCCTGACCGTGTTAAGTACTTGGGCCCATTCTATGGCGAGTCCCAAGCTACTAGACTGGCXGAATTC
CCTGGTGACTATGGATCGGATACCGCTGGACTTTCACCAGACCCTGAAACCTTTGCCAAGAACCATGAACTTGAGGTGATCCACTGX\
Edits in Original Sequence 
(5')GCTGGACAGGCAGCGAAACTATCACCATCTGCCTCAGAAATTTCTGGAAATGGAAGGATCACTATGAGAAAGGCTCGGCGCTATTC
CGCCCCATCTAGCACCCCATGGGATGGCCCTGACCGTGTTAAGTACTTGGGCCCATTCTATGGCGAGTcCCCAAGCTACTAGACTGGCXG
AATTCCCTGGTGACTATGGATCGGATACCGCTGGACTTTCACCAGACCCTGAAACCTTTGCCAAGAACCATGAACTTGAGGTGATCCACT
GX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan