ESTScan Details for Unigene SGN-U290902

Score 
110
Direction 
Reverse
Predicted Peptide Sequence 
AKKAYPQAWIRIIGLDNVRQVQCISFIAYKPEGY
Predicted Coding Sequence 
GCAAAGAAGGCTTACCCACAGGCATGGATCCGTATCATCGGATTGGACAACGTTCGTCAAGTGCAGTGCATCAGTTTCATTGCTTACAAG
CCCGAAGGATACTAA\
Edits in Original Sequence 
(5')GCAAAGAAGGCTTACCCACAGGCATGGATCCGTATCATCGGATTGGACAACGTTCGTCAAGTGCAGTGCATCAGTTTCATTGCTTA
CAAGCCCGAAGGATACTAA\(3')AATGCCAAGTTTTAATTAATGTAATGTATAACTGCCCCTATGTATTTAGGGGAAGCTTGTTTGAAT
CCTCCTTAAGTTTTTCCCTGGAGAAACTGTATTAATTTTACGTTGTTGTTTCCCTTCATCTTTCGAATTAATGGCATTTGTTTTAATACT
AATCTGCTCCTGAAACTTGTAATCAGTTATAATTTATCCAAGTAATATCTTCCATTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
GGGGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan