ESTScan Details for Unigene SGN-U291048

Score 
207
Direction 
Reverse
Predicted Peptide Sequence 
KVIKQILWIEGVRYELREIYGINNSEEINVNDEESGKECVICMTEQKDTAVLPCRHMCLCGECAKELRHQSNKCPICRQPIEELLEIKVN
EAAS
Predicted Coding Sequence 
AAAGTGATCAAGCAGATTTTATGGATTGAAGGAGTTCGTTATGAGCTCAGAGAGATTTATGGGATCAACAATTCAGAGGAAATTAATGTC
AATGATGAGGAGTCAGGAAAAGAATGTGTAATTTGCATGACTGAGCAGAAAGACACGGCAGTTTTGCCATGTAGACATATGTGTTTGTGT
GGTGAGTGTGCCAAAGAACTGAGGCATCAATCAAATAAGTGCCCCATATGCCGCCAACCCATTGAGGAACTTTTGGAGATTAAGGTCAAC
GAAGCTGCATCATAA\
Edits in Original Sequence 
(5')AAAGTGATCAAGCAGATTTTATGGATTGAAGGAGTTCGTTATGAGCTCAGAGAGATTTATGGGATCAACAATTCAGAGGAAATTAA
TGTCAATGATGAGGAGTCAGGAAAAGAATGTGTAATTTGCATGACTGAGCAGAAAGACACGGCAGTTTTGCCATGTAGACATATGTGTTT
GTGTGGTGAGTGTGCCAAAGAACTGAGGCATCAATCAAATAAGTGCCCCATATGCCGCCAACCCATTGAGGAACTTTTGGAGATTAAGGT
CAACGAAGCTGCATCATAA\(3')GCTGGGATATTGTGACAGTGGAAGGTTTGTGTTTTTGGTGTACTATTCAGCGTGTGATTGTGTAGC
ACAGAGATTGTATATAATACGGTGAATAATACAAAGTTTTTGTCAAGATTTTCATCTTTTTCTTAAAGGAAATTGGAGTAAAAAAAAAAA
AAAACCTCTTTGTTTGTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan