ESTScan Details for Unigene SGN-U291061

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
FKQRRVDEDGMXVLDPMQRHYAERTYGFSSSKFNSTSGNAAPLENRNMLMGKARKEILKKLNEWRLQPQDAQKYKVKEGKKEKQRTANVL
GHNVNGNESYQLLKGVKKGVNASANDAHQEDPVPESMNVPDPDFHNFDQDSGESCFEDNEVWASYDADDGMPRFYALINKVLSREPFKVR
HSWLIPKPDNEFGPMEMGSFSFYKTSGELYGLVGYEMVSR
Predicted Coding Sequence 
XCTTTTAAACAGAGAAGGGTCGATGAGGATGGAATGCXGGTTTTGGATCCAATGCAGCGTCACTATGCTGAAAGGACTTATGGTTTTTCT
TCTAGCAAGTTTAATAGTACCAGTGGGAATGCTGCACCACTTGAAAACCGGAATATGCTGATGGGGAAAGCTCGGAAAGAGATACTTAAG
AAGTTGAATGAATGGAGATTGCAGCCGCAAGATGCACAAAAATACAAGGTAAAAGAGGGCAAAAAAGAAAAACAGAGGACTGCTAATGTT
CTTGGTCATAATGTAAACGGGAATGAGAGTTATCAGCTATTGAAGGGAGTAAAGAAAGGTGTCAATGCTTCAGCTAATGATGCACATCAA
GAGGATCCAGTGCCAGAATCAATGAATGTACCAGATCCTGATTTTCATAATTTCGACCAGGATAGTGGTGAAAGTTGTTTCGAAGACAAT
GAAGTCTGGGCTTCATATGATGCTGATGATGGCATGCCCCGTTTCTATGCTCTGATAAACAAAGTCCTCTCAAGGGAACCATTTAAAGTG
AGGCACAGTTGGTTAATTCCAAAACCAGACAATGAATTTGGTCCAATGGAAATGGGTAGCTTCAGTTTCTACAAAACTTCTGGTGAACTT
TACGGATTGGTAGGATACGAAATGGTAAGTCGTTGA\
Edits in Original Sequence 
(5')XCTTTTAAACAGAGAAGGGTCGATGAGGATGGAATGCXGGTTTTGGATCCAATGCAGCGTCACTATGCTGAAAGGACTTATGGTTT
TTCTTCTAGCAAGTTTAATAGTACCAGTGGGAATGCTGaCACCACTTGAAAACCGGAATATGCTGATGGGGAAAGCTCGGAAAGAGATAC
TTAAGAAGTTGAATGAATGGAGATTGCAGCCGCAAGATGCACAAAAATACAAGGTAAAAGAGGGCAAAAAAGAAAAACAGAGGACTGCTA
ATGTTCTTGGTCATAATGTAAACGGGAATGtAGAGTTATCAGCTATTGAAGGGAGTAAAGAAAGGTGTCAATGCTTCAGCTAATGATGCA
CATCAAGAGGATCCAGTGCCAGAATCAATGAATGTACCAGATCCTGATTTTCATAATTTCGACCAGGATAGTGaGTGAAAGTTGTTTCGA
AGACAATGAAGTCTGGGCTTCATATGATGCTGATGATGGCATGCCCCGTTTCTATGCTCTGATAAACAAAGTCCTCTCAAGGGAACCATT
TAAAGTGAGGCACAGTTGGTTAATTCCaAAAACCAGACAATGAATTTGGTCCAATGGAAATGGGTAGCTTCAGTTTCTACAAAACTTCTg
GGTGAACTTTACGGATTGGTAGGATACGAAATGGTAAGTCGTTGA\(3')ATTCCTTCTCCCACAAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan