ESTScan Details for Unigene SGN-U291110

Score 
267
Direction 
Forward
Predicted Peptide Sequence 
KLVDPPGPAGKNXEIWPYVPYSMVAHPYAAAVYDKKAPPNFVRATADPSVAHLNPVEEQYSLMFSDENPNACNIM
Predicted Coding Sequence 
AAACTAGTGGATCCCCCXGGCCCTGCAGGTAAAAATGXTGAGATTTGGCCATATGTGCCATATAGTATGGTGGCACATCCTTATGCTGCT
GCTGTTTATGACAAAAAAGCACCTCCTAATTTTGTAAGGGCAACTGCTGATCCTTCTGTTGCTCACTTAAATCCTGTTGAAGAACAATAT
TCCCTTATGTTTAGTGATGAAAATCCAAATGCTTGTAATATTATGTAG\
Edits in Original Sequence 
(5')AAACTAGTGGATCCCCCXGGCCCTGCAGGTAAAAATGXTGAGATTTGGCCATATGTGCCATATAGTATGGTGGCACATCCTTATGC
TGCTGCTGTTTATGACAAAAAAGCACCTCCTAATTTTGTAAGGGCAACTGCTGATCCTTCTGTTGCTCACTTAAATCCTGTTGAAGAACA
ATATTCCCTTATGTTTAGTGATGAAAATCCAAATGCTTGTAATATTATGTAG\(3')TAGTTAATTATAATTTTTTTTCTTTGTTATAAA
GTATATATACTTCTTTATGTGTATTTTTATGTATACTTAAAACCTGTTGAAGAACAGGTAGGCTATGATAAAAAAAAAAAAAAAACAAAA
AAAAAAAAAAAAAACAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan