ESTScan Details for Unigene SGN-U291309

Score 
274
Direction 
Reverse
Predicted Peptide Sequence 
SKLSNDGDRFVDGAIIAAARTLPTWSDGDLPPIPSLERKAVKELQEECHQMLAEFPTTSDEDQKILDLMPECRRTLEAAIKYRLXSEITD
REGYTGLGHLPRQDSVLNMKNSRIXSNLYQKSCSHSRWRQEYGSIAAIQKALSITIAFATHC
Predicted Coding Sequence 
XXCAGTAAACTATCAAATGATGGAGACAGGTTCGTCGATGGAGCAATAATAGCAGCTGCAAGAACATTGCCCACTTGGTCAGATGGAGAT
CTCCCTCCAATTCCAAGTTTAGAGAGGAAAGCAGTGAAGGAGCTGCAAGAAGAATGCCACCAGATGCTTGCAGAATTTCCCACAACTTCT
GACGAAGACCAGAAAATCCTAGATTTGATGCCTGAATGCAGGAGAACACTCGAAGCAGCAATAAAGTATAGATTAXCATCGGAAATTACT
GATAGAGAAGGTTATACAGGCCTTGGACATTTACCAAGACAGGATTCTGTTCTAAACATGAAAAACAGCAGGATATGAAGCAATCTTTAC
CAGAAATCATGTAGCCATAGCAGATGGCGTCAAGAATATGGTTCCATTGCAGCTATCCAGAAAGCTTTGTCTATCACAATAGCTTTTGCA
ACTCATTGTTAA\
Edits in Original Sequence 
(5')XXCAGTAAACTATCAAATGATGGAGACAGGTTCGTCGATGGAGCAATAATAGCAGCTGCAAGAACATTGCCCACTTGGTCAGATGG
AGATCTCCCTCCAATTCCAAGTTTAGAGAGGAAAGCAGTGAAGGAGCTGCAAGAAGAATGCCACCAGATGCTTGCAGAATTTCCCACAAC
TTCTGACGAAGACCAGAAAATCCTAGATTTGATGCCTGAATGCAGGAGAACACTCGAAGCAGCAATAAAGTATAGATTAXCATCGGAAAT
TACTGATAGAGAAGGTTATACAGGCCTTGGACATTTACCAAGACAGGATTCTGTTCTAAACATGAAAAACAGCAGGATATGAAGCAATCT
TTACCAGAAATCATGTAGCCATAGCAGATGGCGTCtAAGAATATGGTTCCATTGCAGCTATCCAGAAAGCTTTGTCTATCACAATAGCTT
TTGCAACTCATTGTTAA\(3')GAACATTTTGAGGGCTTTTGTTGTGGGGGGGAGGGGTTAGGAAGTAGCTAGTAATGGTGTGTAGAATG
CCTTGCACCACCAGTTTTGGAAAGATAGGAAGTGAAGAAAAAAAATGAAAGGTTCTCTGTAGAAATCATGATGAAAATGAAGGATAAGTA
GCTGAATAAAAAGGGGGGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan