ESTScan Details for Unigene SGN-U291319

Score 
444
Direction 
Reverse
Predicted Peptide Sequence 
KKIDNKSYLLVNSKNWEIGKPNIINNFDDSSHENENGSSEDLPLNFQSLSETAIDIRDLHTPQYPKDQLVTKSMLFNKQNHWPSCLSLLD
GEKIDTIDEIETYLSASALSLATFASLLIEFVARLQNVVDCFEELSQRAEFKEPISVKXLKEFIKYSSSLTEVSSSSFLEYGVAFVKKAL
PKVGFFDANLNLVGLKCEY
Predicted Coding Sequence 
AAAAAAATAGACAACAAGTCATATCTCTTGGTCAACTCAAAAAATTGGGAAATTGGAAAACCAAACATTATTAACAATTTTGATGATTCT
TCACATGAAAATGAAAATGGTAGTAGTGAAGATTTGCCATTAAATTTTCAATCACTTAGTGAAACAGCCATTGACATAAGGGATTTGCAT
ACTCCACAATATCCAAAAGATCAATTGGTCACAAAGTCAATGCTATTTAACAAGCAAAATCATTGGCCTTCATGTCTCTCACTACTTGAT
GGTGAGAAGATTGATACAATTGATGAAATTGAAACTTATTTAAGTGCTAGTGCTTTGTCTTTGGCTACTTTTGCTTCACTTCTCATTGAA
TTTGTTGCAAGGCTACAAAATGTGGTTGATTGTTTTGAAGAACTAAGTCAAAGGGCAGAGTTTAAAGAGCCCATTAGTGTCAAGAGXTTA
AAAGAATTTATCAAGTACTCCTCGTCGTTAACTGAAGTTTCAAGTTCGAGTTTCCTTGAGTATGGAGTCGCCTTTGTTAAGAAGGCTTTA
CCCAAAGTGGGATTTTTCGACGCGAATCTGAATTTAGTTGGACTCAAATGTGAATATTGA\
Edits in Original Sequence 
(5')AAAAAAATAGACAACAAGTCATATCTCTTGGTCAACTCAAAAAATTGGGAAATTGGAAAACCAAACATTATTAACAATTTTGATGA
TTCTTCACATGAAAATGAAAATGGTAGTAGTGAAGATTTGCCATTAAATTTTCAATCACTTAGTGAAACAGCCATTGACATAAGGGATTT
GCATACTCCACAATATCCAAAAGATCAATTGGTCACAAAGTCAATGCTATTTAACAAGCAAAATCATTGGCCTTCATGTCTCTCACTACT
TGATGGTGAGAAGATTGATACAATTGATGAAATTGAAACTTATTTAAGTGCTAGTGCTTTGTCTTTGGCTACTTTTGCTTCACTTCTCAT
TGAATTTGTTGCAAGGCTACAAAATGTGGTTGATTGTTTTGAAGAACTAAGTCAAAGGGCAGAGTTTAAAGAGCCCATTAGTGTCAAGAG
XTTAAAAGAATTTATCAAGTACTCCtTCGTCGTTAACTaGAAGTTTCAAGTTCGAGTTTCCTTGAGTATGGAGTCGCCTTTGTTAAGAAG
cGCTTTACCCAAAGTGGGATTTTTCGACGCGAATCTGAATTTAGTTGGACTCAAATGTGAATATTGA\(3')ACACCGAATGGGAAAAAA
AGAATTTATCAAGTATGTTCATAATGTAATAAGTTTGTGTGATATTAGAAAGGCAAAATTGTCATTTGTTTTATAGTTGTGTAAGGAGGA
AAGGTGTTGAATTAGAAAAATGAAATATGTATATTGATGTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan