Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U291354

Score 
441
Direction 
Forward
Predicted Peptide Sequence 
MDHGLLESSGTDDDRPQSQYNRAPAGSIIGGNGRSSISSAPYQRMYVDMEVEIHNLEQDAYGAILRAFKAQSDALTWEKESLITELRKEL
RVSDDEHRDLLTKVNADNRIHSIREWRKTNGNQPVHDQLPSPTVSGSRKRPKMSQSVIMPLGTPFGVLAPSDNCSEHATYYFRCKX
Predicted Coding Sequence 
ATGGACCATGGGCTTTTAGAAAGCAGCGGTACTGATGATGATCGGCCTCAATCACAATATAATCGAGCCCCTGCAGGAAGTATTATAGGT
GGAAACGGTAGGTCTAGTATAAGTTCAGCCCCATACCAAAGGATGTATGTTGATATGGAAGTCGAAATTCACAACCTTGAGCAGGATGCC
TATGGTGCAATCCTTCGAGCTTTCAAAGCACAGTCTGATGCTCTTACATGGGAAAAGGAAAGCTTGATAACAGAACTCAGGAAAGAGCTG
AGAGTGTCAGACGATGAGCACAGAGACCTACTGACCAAGGTCAATGCCGATAACCGTATTCATAGTATCAGGGAGTGGAGAAAGACCAAT
GGAAACCAACCTGTTCATGATCAACTCCCCAGTCCAACAGTTTCTGGATCAAGAAAGAGGCCAAAAATGTCACAATCTGTGATAATGCCA
CTTGGTACCCCGTTTGGAGTCCTTGCACCATCAGACAATTGCAGCGAGCACGCAACCTACTACTTCAGGTGCAAAATX\
Edits in Original Sequence 
TCTTTATTCTTCGTCGAAACTCTGCTTTGTTTTTACCTTTCCTTCTTTCTTTGTCTCTCTCTCTCTACACCTCATGTATTGACGCAGGTG
GCAAGGGCACTAAAAAAAACACAATCTTTTTCTGCATCAGAAAGCCGTTTCATTTCACTTAATTTGTCGAATTCTGAGACTAATATAGTT
TGAAGCACCGGTGT
(5')ATGGACCATGGGCTTTTAGAAAGCAGCGGTACTGATGATGATCGGCCTCAATCACAATATAATCGAGCCCCT
GCAGGAAGTATTATAGGTGGAAACGGTAGGTCTAGTATAAGTTCAGCCCCATACCAAAGGATGTATGTTGATATGGAAGTCGAAATTCAC
AACCTTGAGCAGGATGCCTATGGTGCAATCCTTCGAGCTTTCAAAGCACAGTCTGATGCTCTTACATGGGAAAAGGAAAGCTTGATAACA
GAACTCAGGAAAGAGCTGAGAGTGTCAGACGATGAGCACAGAGACCTACTGACCAAGGTCAATGCCGATAACCGTATTCATAGTATCAGG
GAGTGGAGAAAGACCAATGGAAACCAACCTGTTCATGATCAACTCCCCAGTCCAACAGTTTCTGGATCAAGAAAGAGGCCAAAAATGTCA
CAATCTGTGATAATGCCACTTGGTACCCCGTTTGGAGTCCTTGCACCATCAGACAATTGCAGCGAGCACGCAACCTACTACTTCAGGTGC
AAAATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan